DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reck and fstb

DIOPT Version :9

Sequence 1:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster
Sequence 2:NP_001034720.1 Gene:fstb / 566538 ZFINID:ZDB-GENE-031118-139 Length:344 Species:Danio rerio


Alignment Length:313 Identity:70/313 - (22%)
Similarity:108/313 - (34%) Gaps:132/313 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   640 KKLEVGQFPLAEHIVCSCGL-QGRLEQCQPLPSYMHAHCTLPGARSYRHGSSFYLECNLCSCFAG 703
            :|::.|          :|.| ||:..:||.|               |..|.|             
Zfish    25 QKVQAG----------NCWLQQGKNGRCQVL---------------YMSGMS------------- 51

  Fly   704 EITCTKQQCRLPGFVDSGYT--SLPCNCPAHYVPVCGSNGNTYPSACVAKCHLPEGDYVYGACNA 766
                 ::.|...|.:.:.:|  .:|.|....::...|...|..|  |...|     |.|      
Zfish    52 -----REDCCKSGRLGTAWTEEDVPNNTLFRWLIFNGGAPNCIP--CKETC-----DNV------ 98

  Fly   767 RNACQAAPPNSCPSGTQCLDSRKVCLASMQRPCLQYVCVNATASNCS--TFHQGEVCDSQGRTYP 829
                      .|.||.:|..:::      .:|  :.||    |.:||  || :|.||.|.|:||.
Zfish    99 ----------DCGSGKRCKMNKR------NKP--RCVC----APDCSNVTF-KGPVCGSDGKTYR 140

  Fly   830 NACALLKA----NPQGQVAYWSACQSSRFN-----------------------------TSPSP- 860
            |.||||:|    :|.....|...|:.|.::                             |||.. 
Zfish   141 NECALLRAKCKRHPDLSAQYQGKCKKSCYDVRCPGSSTCVLDQTNNAYCVTCNRFCTEVTSPEQY 205

  Fly   861 VCGINGVTYKSS-YAARAEYVL-----VDYVGRCREVGLLVSDMGRRCRTVKC 907
            :||.:|..|.|: :..||..::     |.|.|:|.:        .|.|:.:.|
Zfish   206 LCGNDGKVYASACHLRRATCIMGRSIGVAYEGKCID--------ARSCKDINC 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052 4/23 (17%)
fstbNP_001034720.1 KAZAL_FS 95..>150 CDD:294071 28/88 (32%)
KAZAL 192..239 CDD:197624 13/46 (28%)
KAZAL 269..316 CDD:197624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.