powered by:
Protein Alignment Reck and Spink6
DIOPT Version :9
Sequence 1: | NP_001261853.1 |
Gene: | Reck / 39629 |
FlyBaseID: | FBgn0036463 |
Length: | 1071 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013819.1 |
Gene: | Spink6 / 433180 |
MGIID: | 3648654 |
Length: | 105 |
Species: | Mus musculus |
Alignment Length: | 36 |
Identity: | 14/36 - (38%) |
Similarity: | 16/36 - (44%) |
Gaps: | 9/36 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 811 NCSTFHQGEV---------CDSQGRTYPNACALLKA 837
||..|...:| |.|.|:||.|.||..||
Mouse 54 NCGEFRDPKVFCTRESDPLCGSDGQTYGNKCAFCKA 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Reck | NP_001261853.1 |
KAZAL_FS |
729..>753 |
CDD:238052 |
|
Spink6 | NP_001013819.1 |
Kazal_1 |
61..105 |
CDD:395004 |
11/29 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3649 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.