DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reck and TMEFF2

DIOPT Version :9

Sequence 1:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster
Sequence 2:NP_057276.2 Gene:TMEFF2 / 23671 HGNCID:11867 Length:374 Species:Homo sapiens


Alignment Length:297 Identity:68/297 - (22%)
Similarity:102/297 - (34%) Gaps:105/297 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   686 RHGSSFYLECNLCSCFAGE-------ITCTKQQCRLPGFVDSGYTSLPCNCPAHYVPVCGSNGNT 743
            |....|..:.|.|. |.||       :||.   |:.             .|...|||||||||.:
Human    62 RENDLFLCDTNTCK-FDGECLRIGDTVTCV---CQF-------------KCNNDYVPVCGSNGES 109

  Fly   744 YPSACV---AKCHLP------------------EGDYVYGACNARNACQAAPPNSCPSGTQC-LD 786
            |.:.|.   |.|...                  .||.|:......:..:.:..:.|..|.:| .|
Human   110 YQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDED 174

  Fly   787 SRKV-CLASMQRPCLQYVCVNATASNCSTFHQGEVCDSQGRTYPNACALLKANPQGQ----VAYW 846
            :..| |:.::               :||..:...:|.|.|::|.|||.:.:|:.|.|    |...
Human   175 AEDVWCVCNI---------------DCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSL 224

  Fly   847 SACQSSRFNTSPSPVCGINGVTYKSSYA---------ARAEYVLV--DYVGRCREVGLLVSDMGR 900
            ..||.:...|:.|.    :|...::.||         ||..::..  .|.|.|         |..
Human   225 GRCQDNTTTTTKSE----DGHYARTDYAENANKLEESAREHHIPCPEHYNGFC---------MHG 276

  Fly   901 RCR--------TVKCPAP-VSKHCR------LIVPPG 922
            :|.        :.:|.|. ..:||.      |.|.||
Human   277 KCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052 13/26 (50%)
TMEFF2NP_057276.2 KAZAL_FS 95..135 CDD:238052 14/39 (36%)
KAZAL 181..227 CDD:197624 13/60 (22%)
PHA02887 <236..301 CDD:165214 14/77 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.