DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reck and Fst

DIOPT Version :9

Sequence 1:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster
Sequence 2:NP_001288302.1 Gene:Fst / 14313 MGIID:95586 Length:344 Species:Mus musculus


Alignment Length:352 Identity:78/352 - (22%)
Similarity:118/352 - (33%) Gaps:122/352 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   677 CTLPGARSYRHGSSFYLECNLCSC---FAGEITCTKQQCRLPGFVDSGYTSLPCNCPAHYVPVCG 738
            |.....||.:.|:.:..:.....|   :..|:  :|::|...|.:.:.:|....           
Mouse    19 CQFMEDRSAQAGNCWLRQAKNGRCQVLYKTEL--SKEECCSTGRLSTSWTEEDV----------- 70

  Fly   739 SNGNTYPSACVAKCHLPEGDYVYGACN---ARNACQAAPPNSCPSGTQCLDSRKVCLASMQRPCL 800
             |.||     :.|..:..|    ||.|   .:..|:..   .|..|.:|..::|      .:|  
Mouse    71 -NDNT-----LFKWMIFNG----GAPNCIPCKETCENV---DCGPGKKCRMNKK------NKP-- 114

  Fly   801 QYVCVNATASNCSTF-HQGEVCDSQGRTYPNACALLKA----NPQGQVAYWSACQS--------- 851
            :.||    |.:||.. .:|.||...|:||.|.||||||    .|:.:|.|...|:.         
Mouse   115 RCVC----APDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPG 175

  Fly   852 -----------------SRFNTSPSP----VCGINGVTYKSSYAARAEYVLVD------YVGRCR 889
                             :|....||.    :||.:||||.|:...|....|:.      |.|:|.
Mouse   176 SSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI 240

  Fly   890 EVGLLVSDMGRRCRTVKCPAPVSKHC--RLIVPPGAC------C-------PLCAGGAFRIIYSR 939
            :        .:.|..::|..  .|.|  ...|..|.|      |       |:||.         
Mouse   241 K--------AKSCEDIQCGG--GKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCAS--------- 286

  Fly   940 KQFDRAMYGLRAQSSTLLTLQGVLQQL 966
               |.|.|.............|||.::
Mouse   287 ---DNATYASECAMKEAACSSGVLLEV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052 4/23 (17%)
FstNP_001288302.1 FOLN 95..116 CDD:370409 6/31 (19%)
KAZAL 117..164 CDD:197624 21/50 (42%)
FOLN 167..190 CDD:128570 0/22 (0%)
KAZAL 192..239 CDD:197624 14/46 (30%)
KAZAL 270..316 CDD:197624 10/53 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.