DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reck and Fstl3

DIOPT Version :9

Sequence 1:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster
Sequence 2:NP_446081.1 Gene:Fstl3 / 114031 RGDID:621811 Length:256 Species:Rattus norvegicus


Alignment Length:300 Identity:59/300 - (19%)
Similarity:88/300 - (29%) Gaps:123/300 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 EITC--------TKQQCRLPGFVDSGYTSLPCNCPAHYVPVCGSNGNTYPSACVAKCHLPEGDYV 760
            |.||        ::::|...|.:::.:::.  ..|.:.:.:.|..|..:...|...|        
  Rat    43 EATCSLVLKTQVSREECCASGNINTAWSNF--THPGNKISLLGFLGLVHCLPCKDSC-------- 97

  Fly   761 YGACNARNACQAAPPNSCPSGTQCLDSRKVCLASMQRPCLQYVCVNATASNCSTFHQG-EVCDSQ 824
                   :..:..|..:|    :.|..|..|           .||    |||.....| :||.|.
  Rat    98 -------DGVECGPGKAC----RMLGGRPHC-----------ECV----SNCEGVPAGFQVCGSD 136

  Fly   825 GRTYPNACAL----LKANPQGQVAYWSACQSSRFNTSPSPVCGINGVTYKSSYAARAEYVLVDYV 885
            |.||.:.|.|    .:.:|..:|.|...||.|    ....||            .|.:..|||..
  Rat   137 GATYRDECELRTARCRGHPDLRVMYRGRCQKS----CAQVVC------------PRPQSCLVDQT 185

  Fly   886 GRCREVGLLVSDMGRRCRTVKCPAPVSKHCRLIVPPGACCPLCAGGAFRIIYSRKQFDRAMYGLR 950
            |....|         .||...||          |||.....||..                    
  Rat   186 GSAHCV---------VCRAAPCP----------VPPNPGQELCGN-------------------- 211

  Fly   951 AQSSTLLTLQGVLQQLDGLVQVSEC---QLTGFLTMEVGI 987
                            :.:..:|.|   |.|.||...:|:
  Rat   212 ----------------NNVTYISSCHLRQATCFLGRSIGV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052 4/23 (17%)
Fstl3NP_446081.1 KAZAL 118..165 CDD:197624 17/50 (34%)
KAZAL_FS 198..241 CDD:238052 14/83 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.