DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reck and Spink10

DIOPT Version :9

Sequence 1:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster
Sequence 2:XP_002728606.3 Gene:Spink10 / 100361300 RGDID:2320365 Length:160 Species:Rattus norvegicus


Alignment Length:152 Identity:34/152 - (22%)
Similarity:48/152 - (31%) Gaps:57/152 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 FVDSGYTSLPCNCPAHYVPVCGSNGNTYPSACVAKCHLPEGDYVYGACNARNACQAAPPNSCPSG 781
            |:|        .|...|.|:|.:||.||.:.|:                   .|.|...:..||.
  Rat    43 FID--------KCTKEYYPMCATNGQTYCNKCI-------------------FCNALKLDKMPSS 80

  Fly   782 -------------------TQCLDSRKVCLASMQRP-CLQYVCVNATASNCSTFHQGEVCDSQGR 826
                               |....|::|    ..:| |.:|    ....|..|.....||.:.|.
  Rat    81 SLWIKIIFILALVGLFYYETTFTFSKQV----RHKPDCDKY----KEFPNRCTREINPVCGTNGH 137

  Fly   827 TYPNACALLKA--NPQGQVAYW 846
            ||.|.|....|  ..:|::.||
  Rat   138 TYDNECIFCNAMITSKGKIDYW 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052 9/23 (39%)
Spink10XP_002728606.3 KAZAL_FS 37..>71 CDD:294071 12/54 (22%)
Kazal_1 114..157 CDD:278479 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.