DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reck and Spink13

DIOPT Version :9

Sequence 1:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster
Sequence 2:XP_006525523.2 Gene:Spink13 / 100038417 MGIID:3642511 Length:137 Species:Mus musculus


Alignment Length:61 Identity:19/61 - (31%)
Similarity:28/61 - (45%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 KQQCRLPGFVDSGYTSLPCNCPAHYVPVCGSNGNTYPSA---CVAKCHL-PEGDYV-YGAC 764
            |..|::...:|..|.:   |||.....||.:||.||.:.   |:.:... |...:| ||.|
Mouse    79 KPPCKMYYPIDPDYEA---NCPDVKAYVCATNGLTYKNECFFCIDRWEFGPHIQFVKYGKC 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052 9/26 (35%)
Spink13XP_006525523.2 KAZAL 95..136 CDD:197624 14/40 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.