DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reck and fsta

DIOPT Version :9

Sequence 1:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster
Sequence 2:XP_005165314.1 Gene:fsta / 100004116 ZFINID:ZDB-GENE-990714-11 Length:349 Species:Danio rerio


Alignment Length:264 Identity:67/264 - (25%)
Similarity:88/264 - (33%) Gaps:72/264 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   588 CAQKPCNGSEVCILQRGGNQGYSCIPGCNLGQDSKLFVPFGSYVRLGKSNLHKKLEVGQFPLAEH 652
            |....|...:.|.:.|.......|.|.|                    ||:..|..|        
Zfish    98 CDNVDCGPGKRCKMNRRSKPRCVCAPDC--------------------SNVTWKGPV-------- 134

  Fly   653 IVCSCGLQGRL--EQCQPLPSYMHAHCTLPGARSYRHGSSFYLECNLCSCFAGEITCTKQQCRLP 715
                ||..|:.  ::|..|.|....|..|    ..::.......|....| .|..||...|    
Zfish   135 ----CGSDGKTYRDECALLKSKCKGHPDL----EVQYQGKCKKTCRDVLC-PGSSTCVVDQ---- 186

  Fly   716 GFVDSGYTSLPCN--CPAHYVP---VCGSNGNTYPSAC---VAKCHLPE--GDYVYGACNARNAC 770
              .::.| .:.||  ||....|   :||::|..|.|||   .|.|.|..  |....|.|....:|
Zfish   187 --TNNAY-CVTCNRICPEVMSPDQYLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKCIKAKSC 248

  Fly   771 QAAPPNSCPSGTQCLDSRKVCLASMQR-PCLQYVCVNATASNCSTFHQGE-VCDSQGRTYPNACA 833
            ...   .|.:|.:||..     |.|.| .|.  ||    |.:|......| ||.|...|||:.||
Zfish   249 DDI---HCSAGKKCLWD-----AKMSRGRCA--VC----AESCPESRSEEAVCASDNTTYPSECA 299

  Fly   834 LLKA 837
            :.:|
Zfish   300 MKQA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052 11/29 (38%)
fstaXP_005165314.1 KAZAL 120..167 CDD:197624 15/82 (18%)
KAZAL_FS 199..242 CDD:238052 15/42 (36%)
KAZAL 272..319 CDD:197624 14/36 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.