DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and PRE5

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_014045.1 Gene:PRE5 / 855362 SGDID:S000004931 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:199 Identity:43/199 - (21%)
Similarity:80/199 - (40%) Gaps:26/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCG-------AGTAADTEMT 94
            |.|:..||:......:|          :...:|..::....|.|..|.       ||.|.|..:.
Yeast    30 KQGSVTVGLRSNTHAVL----------VALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVL 84

  Fly    95 TDLISSQLELHRLQTDREVRVVAANTML----KQMLFRYQGH-ISAALVLGGVDKTGPHIYSIHP 154
            ::.:..|.....|..:|::.|..|..:|    ::....|.|. ....|::.|.||:|.|:....|
Yeast    85 SNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQP 149

  Fly   155 HGSSDKLPYATMGSGSLAAMTVFESRW----KPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLC 215
            .|:..:|....:|:.|..|.|..|...    |.|.:.:|..|...:||:..:.::..:..|:.:.
Yeast   150 SGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIA 214

  Fly   216 VIRK 219
            ::.|
Yeast   215 IVGK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 41/194 (21%)
proteasome_beta_type_7 42..228 CDD:239732 41/194 (21%)
Pr_beta_C 232..264 CDD:289249
PRE5NP_014045.1 Ntn_hydrolase 6..217 CDD:412394 42/196 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.