DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and PRE10

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_015007.1 Gene:PRE10 / 854544 SGDID:S000005889 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:67/279 - (24%)
Similarity:109/279 - (39%) Gaps:53/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DLPRAGFNFDNCKRNATLLNRGFKPPTTTK---TGTTIVGIIYKDGVILGADTRATEGPIVSDKN 69
            ||..:.|:.|         .|.|:.....|   .|||.:||...|||:...:...|...:|..||
Yeast     9 DLSNSVFSPD---------GRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKN 64

  Fly    70 CAKIHYLAKNIYCCGAGTAAD----TEMTTDLISSQLELHRLQ------TDREVRVVAANTMLKQ 124
             .||..:.::|.|..:|...|    .....:..:|..:|::..      .||..:.|.|:|    
Yeast    65 -VKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHT---- 124

  Fly   125 MLFRYQGHISAALVLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEE 189
             |:........:.:.|||||.|.|:|.:.|.||......|..|.|..:|             :.|
Yeast   125 -LYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSA-------------KAE 175

  Fly   190 GKKLVRDAIASGVFNDLGSGSNIDLCVIRKGSVEYLRNYELANKKGKRQLDYRFKTGTST-VLHT 253
            .:|||         :....|.:....|.:...:.||.:.:  ||:...:|:..:.:.:.| .||.
Yeast   176 LEKLV---------DHHPEGLSAREAVKQAAKIIYLAHED--NKEKDFELEISWCSLSETNGLHK 229

  Fly   254 NIKDLLVTERVQAVPMEIS 272
            .:|..|:.|.:.....||:
Yeast   230 FVKGDLLQEAIDFAQKEIN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 46/199 (23%)
proteasome_beta_type_7 42..228 CDD:239732 46/195 (24%)
Pr_beta_C 232..264 CDD:289249 9/32 (28%)
PRE10NP_015007.1 proteasome_alpha_type_3 5..219 CDD:239720 59/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.