DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and PRE6

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_014604.1 Gene:PRE6 / 854119 SGDID:S000005398 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:53/235 - (22%)
Similarity:90/235 - (38%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTGTTIVGIIYKDGVILGADTRAT---EGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLI 98
            |.||..||:..|:.|:||.:.|:|   :...::....:||.   .::....:|..||:.:..:..
Yeast    28 KRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKID---SHVVLSFSGLNADSRILIEKA 89

  Fly    99 SSQLELHRLQTDREVRVVAANTMLKQMLFRYQGHISAALV-LGGVDKTG--------------PH 148
            ..:.:.|||..:..|.|        :.|.||...:..... .|||...|              |.
Yeast    90 RVEAQSHRLTLEDPVTV--------EYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPK 146

  Fly   149 IYSIHPHGSSDKLPYATMGSGSLAAMTVFE---SRWKPDLSEEEGKKL-VR---DAIASGVFNDL 206
            :|...|.|........|:|..|.......|   .|.:|..:.||..|| ||   :.:.:|     
Yeast   147 LYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTG----- 206

  Fly   207 GSGSNIDLCVIRKG------SVEYLRNY--ELANKKGKRQ 238
              ..||::.|::..      |.|.:..|  ::..:|.::|
Yeast   207 --AKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 48/222 (22%)
proteasome_beta_type_7 42..228 CDD:239732 47/216 (22%)
Pr_beta_C 232..264 CDD:289249 2/7 (29%)
PRE6NP_014604.1 proteasome_alpha_type_7 4..215 CDD:239724 47/204 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.