DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and PUP2

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_011769.1 Gene:PUP2 / 853168 SGDID:S000003485 Length:260 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:51/208 - (24%)
Similarity:89/208 - (42%) Gaps:15/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQ 101
            |.|:|.:||..|:||:||.:.||| .|::...:..||..:.::|.|..:|..||.....:...:.
Yeast    32 KLGSTAIGIATKEGVVLGVEKRAT-SPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTA 95

  Fly   102 LELHRLQTDREVRVVAANTMLKQMLFRYQGHIS-----------AALVLGGVD-KTGPHIYSIHP 154
            ...|.|..|.::.|.:....:..:..|:....|           .||::.|.| ..|..::...|
Yeast    96 AVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEP 160

  Fly   155 HGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDL-CVIR 218
            .|:..:.....:||||..|.....:.|...|:.:|.:.||. .|...|..:....:|..| |:.:
Yeast   161 SGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVL-KILKQVMEEKLDENNAQLSCITK 224

  Fly   219 KGSVEYLRNYELA 231
            :...:...|.:.|
Yeast   225 QDGFKIYDNEKTA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 48/203 (24%)
proteasome_beta_type_7 42..228 CDD:239732 46/198 (23%)
Pr_beta_C 232..264 CDD:289249 51/208 (25%)
PUP2NP_011769.1 proteasome_alpha_type_5 8..222 CDD:239722 48/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.