DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and PRE9

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_011651.3 Gene:PRE9 / 853036 SGDID:S000003367 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:52/226 - (23%)
Similarity:98/226 - (43%) Gaps:25/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTE--MTTDLISSQLE 103
            |.:||:..||::|.|:.:.|...:..|.:..|::.|...|....||..||.|  :.|..|.:|..
Yeast    34 TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNY 98

  Fly   104 LHRLQTDREVRVVAAN-TMLKQMLFRYQG--HISAALVLGGV-DKTGPHIYSIHPHGSSDKLPYA 164
            |.....|..|.::... :.:||...::.|  ....:.:..|. |:.|..:|:.:|.|:.......
Yeast    99 LKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAI 163

  Fly   165 TMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRKGSVEYLRNYE 229
            ::|:.:.||.|:.:..:|.|:..::..:|....::....:...:...::...||||:    .:.|
Yeast   164 SVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGA----NDGE 224

  Fly   230 LANKKGKRQLDYRFKTGTSTVLHTNIKDLLV 260
            :..|..|.|               .|||:||
Yeast   225 VYQKIFKPQ---------------EIKDILV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 43/195 (22%)
proteasome_beta_type_7 42..228 CDD:239732 42/191 (22%)
Pr_beta_C 232..264 CDD:289249 8/29 (28%)
PRE9NP_011651.3 proteasome_alpha_type_4 4..216 CDD:239721 39/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.