DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Psmb11

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_780413.1 Gene:Psmb11 / 73902 MGIID:1921152 Length:302 Species:Mus musculus


Alignment Length:225 Identity:60/225 - (26%)
Similarity:104/225 - (46%) Gaps:17/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPRAGFNFDNCKRNATLLNRGFKPPTTTKT-------GTTIVGIIYKDGVILGADTRATEGPIVS 66
            ||:||         ...:.||..|.|..:.       |||.:...::.|||..||||::.|..|:
Mouse    21 LPQAG---------GWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVA 76

  Fly    67 DKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQLELHRLQTDREVRVVAANTMLKQMLFRYQG 131
            .....|:..:.:.:....:||:||......::..:|.|..|:..:...|.....:|..|:..|:|
Mouse    77 CPASRKVIPVHQRLLGTTSGTSADCATWYRVLRRELRLRELREGQLPSVAGTAKLLAAMMSCYRG 141

  Fly   132 -HISAALVLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVR 195
             .:..|..|.|.|.:||.::.::..|:..:....::||||..|..|.:..:..|::.:|...|.|
Mouse   142 LDLCVATALCGWDHSGPALFYVYSDGTCLQGDIFSVGSGSPYAYGVLDRGYHYDMTIQEAYTLAR 206

  Fly   196 DAIASGVFNDLGSGSNIDLCVIRKGSVEYL 225
            .|:|.....|..||.::||..:|:...||:
Mouse   207 CAVAHATHRDAYSGGSVDLFHVRESGWEYV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 49/185 (26%)
proteasome_beta_type_7 42..228 CDD:239732 49/185 (26%)
Pr_beta_C 232..264 CDD:289249
Psmb11NP_780413.1 20S_bact_beta 48..253 CDD:163402 52/189 (28%)
proteasome_beta_type_5 50..237 CDD:239730 51/187 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.