DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and psmb3

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001123295.1 Gene:psmb3 / 573095 ZFINID:ZDB-GENE-040426-2682 Length:205 Species:Danio rerio


Alignment Length:192 Identity:47/192 - (24%)
Similarity:90/192 - (46%) Gaps:12/192 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GTTIVGIIYKDGVILGADTR-ATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQL 102
            |..::.:..|:.|.:.:|.| ..:..:|: .:..||..:.:.:|...||.|.|.:..:..:..:|
Zfish     8 GGAVMAMRGKECVAIASDRRFGIQAQLVT-TDFQKIFPMGERLYIGLAGLATDVQTVSQRLKFRL 71

  Fly   103 ELHRLQTDREVRVVAANTMLKQMLF-RYQGHISAALVLGGVD-KT-GPHIYSIH----PHGSSDK 160
            .|:.|:..|:::.....:|:..:|: |..|......|:.|:| || .|.|.|:.    |..:.| 
Zfish    72 NLYELKEGRQIKPRTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPFICSLDLIGCPMVTED- 135

  Fly   161 LPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRKGSV 222
              :...|:.|.....:.||.|:||:..|:..:.:..|:.:.|..|..||..:.:.||.|..:
Zfish   136 --FVVSGTCSEQMYGMCESLWEPDMKPEDLFETISQAMLNAVDRDAVSGMGVVVHVIEKDKI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 46/189 (24%)
proteasome_beta_type_7 42..228 CDD:239732 46/189 (24%)
Pr_beta_C 232..264 CDD:289249
psmb3NP_001123295.1 PRE1 3..198 CDD:223711 47/192 (24%)
proteasome_beta_type_3 6..201 CDD:239728 47/192 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.