DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and PSMA4

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001096137.1 Gene:PSMA4 / 5685 HGNCID:9533 Length:261 Species:Homo sapiens


Alignment Length:224 Identity:52/224 - (23%)
Similarity:99/224 - (44%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQLELH 105
            |.:||:..|||:|.|:.|.....:.......||:.|.:::.|..||..:|..:.|:.:....:.:
Human    33 TCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRY 97

  Fly   106 RLQTDREV---RVVAANTMLKQMLFRYQGH--ISAALVLGGVDK-TGPHIYSIHPHGSSDKLPYA 164
            .||....:   ::|.|...:||...::.|.  ...:|:..|.|| .|..:|...|.|:.......
Human    98 LLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKAT 162

  Fly   165 TMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASG--VFN---DLG--SGSNIDLC------- 215
            .:|:.|.||:::.:..:|      ||:..::.|:|..  |.|   |:.  |...:::.       
Human   163 CIGNNSAAAVSMLKQDYK------EGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENG 221

  Fly   216 -----VIRKGSVEYL-RNYELANKKGKRQ 238
                 |:::..||.| :.:|....|.:|:
Human   222 KTVIRVLKQKEVEQLIKKHEEEEAKAERE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 49/215 (23%)
proteasome_beta_type_7 42..228 CDD:239732 48/211 (23%)
Pr_beta_C 232..264 CDD:289249 2/7 (29%)
PSMA4NP_001096137.1 proteasome_alpha_type_4 3..216 CDD:239721 45/188 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.