DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and PSMA3

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_002779.1 Gene:PSMA3 / 5684 HGNCID:9532 Length:255 Species:Homo sapiens


Alignment Length:171 Identity:36/171 - (21%)
Similarity:63/171 - (36%) Gaps:20/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQ 101
            :..:|.:||..||||:.|.: :.....:..:.:..::..:.:::....||..||.....|:...:
Human    32 ENSSTAIGIRCKDGVVFGVE-KLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREE 95

  Fly   102 LELHRLQ----------TDREVRVVAANTMLKQMLFRYQGHISAALVLGGVD-KTGPHIYSIHPH 155
            ....|..          .||....|.|.|     |:........:.:||... ..|..:|.|.|.
Human    96 ASNFRSNFGYNIPLKHLADRVAMYVHAYT-----LYSAVRPFGCSFMLGSYSVNDGAQLYMIDPS 155

  Fly   156 GSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRD 196
            |.|.......:|....||.|..|   |..:.|...:.:|::
Human   156 GVSYGYWGCAIGKARQAAKTEIE---KLQMKEMTCRDIVKE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 35/166 (21%)
proteasome_beta_type_7 42..228 CDD:239732 35/166 (21%)
Pr_beta_C 232..264 CDD:289249
PSMA3NP_002779.1 proteasome_alpha_type_3 5..217 CDD:239720 36/171 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.