DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Prosbeta1

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:221 Identity:59/221 - (26%)
Similarity:111/221 - (50%) Gaps:14/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TTTKTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLI 98
            |...|||||:.:.:..||::|||:|.:.|..|:::...|:..:...:|||.:|:||||:...|::
  Fly    10 TPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIV 74

  Fly    99 SSQLELHRLQTDREVRVVAANTMLKQMLFRYQGHISAALVLGGVD-KTGPHIYSIHPHGSSDKLP 162
            :..|..|..||:::..|..|.:..:...:.|:..:.|.:::.|.| :.|..:|||...|...:..
  Fly    75 AYSLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRES 139

  Fly   163 YATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRKGSVEYLRN 227
            ....||||..........::|:::.|:....|:.|:...:::|..||..:.:.:|.|..:|    
  Fly   140 CTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIE---- 200

  Fly   228 YELANKKGKRQLDYRFKTGTSTVLHT 253
                     |::.|..::|.|.|..|
  Fly   201 ---------RRIFYNTESGASAVSST 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 48/190 (25%)
proteasome_beta_type_7 42..228 CDD:239732 48/186 (26%)
Pr_beta_C 232..264 CDD:289249 6/22 (27%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 51/198 (26%)
proteasome_beta_type_6 16..203 CDD:239731 51/199 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441190
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.