DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and psmb11a

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001007179.1 Gene:psmb11a / 446135 ZFINID:ZDB-GENE-040724-32 Length:375 Species:Danio rerio


Alignment Length:319 Identity:72/319 - (22%)
Similarity:121/319 - (37%) Gaps:86/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AGFNF-----DNCKRN--ATLLNRGFKP---PTTTKTGTTIVGIIYKDGVILGADTRATEGPIVS 66
            :.|||     .:|::|  :||.:....|   |.....|||.:|.|::||||..|||||:...:|.
Zfish    40 SSFNFHLPAQQSCRKNTASTLFSSTLSPHEQPFHLSHGTTTLGFIFQDGVIAAADTRASCKGLVC 104

  Fly    67 DKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQLELHRLQTDREVRVVAANTMLKQMLFRYQG 131
            .....||..:..::....:|:.||..:...:::.::.|::|:....:.:..|..:|..||..::|
Zfish   105 CPITHKIMPIHSHLVVNTSGSGADCMLWERILTREMRLYQLRHRTRLSINGAAKLLSTMLHPFKG 169

  Fly   132 -HISAALVLGGVD--------KT------------------------------------------ 145
             ::..|..|.|.|        ||                                          
Zfish   170 TNVCVAATLCGWDGEESQIQWKTSMGTVNVNESMAQDSTLSAISDESALGSEKRASISEQEEILK 234

  Fly   146 ---------------GPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVR 195
                           ||.:..:...|........::||||..|..|.:..|:..::.:|...|.|
Zfish   235 DVPDQQNRSTFGGRFGPRVCYVCSDGLQLNGEIISVGSGSPYAYAVLDDGWRWGMTVDEAVGLAR 299

  Fly   196 DAIASGVFNDLGSGSNIDLCVI-RKG---------SVEYLRNYELANKKGKRQLDYRFK 244
            :|:......|..||:|:||..| .:|         ..||.|..|...:|.|.:.:.|.|
Zfish   300 EAVFRATHWDAYSGNNVDLFYITARGWRRREREDLKEEYYREREREREKIKEREEERQK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 56/265 (21%)
proteasome_beta_type_7 42..228 CDD:239732 55/261 (21%)
Pr_beta_C 232..264 CDD:289249 4/13 (31%)
psmb11aNP_001007179.1 20S_bact_beta 76..334 CDD:163402 55/257 (21%)
proteasome_beta_type_5 78..330 CDD:239730 54/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.