DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and psmb10

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio


Alignment Length:265 Identity:145/265 - (54%)
Similarity:188/265 - (70%) Gaps:7/265 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GFNFDNCKRN----ATLLNRGFKPPTTTKTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKI 73
            ||:|:|.:||    |.|..:|:..|...||||||.|:::|||||||||||||:..:|:||||.||
Zfish    12 GFSFENTRRNAVLEANLSEKGYSAPNARKTGTTIAGLVFKDGVILGADTRATDDMVVADKNCMKI 76

  Fly    74 HYLAKNIYCCGAGTAADTEMTTDLISSQLELHRLQTDREVRVVAANTMLKQMLFRYQGHISAALV 138
            ||:|.||||||||.|||.|:||.::||.:|||.|.|.|...|......||||||||||||.::|:
Zfish    77 HYIAPNIYCCGAGVAADAEVTTQMMSSNVELHSLSTGRPPLVAMVTRQLKQMLFRYQGHIGSSLI 141

  Fly   139 LGGVDKTGPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVF 203
            :||||..|..:||::||||.||||:.|||||:.:|::|||.|:||::..||.|:||||||.:|:|
Zfish   142 VGGVDVNGAQLYSVYPHGSYDKLPFLTMGSGAASAISVFEDRYKPNMELEEAKQLVRDAITAGIF 206

  Fly   204 NDLGSGSNIDLCVIRKGSVEYLRNYELANKKGKRQLDYRFKTGTSTVLHTNIKDL---LVTERVQ 265
            .|||||||:|||||....|:|||.|:....|.:|...||:|.||:.||...:..|   :|.|.|.
Zfish   207 CDLGSGSNVDLCVITDKKVDYLRTYDQPVHKNQRGGTYRYKPGTTAVLSKTVTPLTLDVVDESVH 271

  Fly   266 AVPME 270
            .:..|
Zfish   272 VMDTE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 116/189 (61%)
proteasome_beta_type_7 42..228 CDD:239732 115/185 (62%)
Pr_beta_C 232..264 CDD:289249 12/34 (35%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 116/183 (63%)
proteasome_beta_type_7 43..231 CDD:239732 117/187 (63%)
Pr_beta_C 237..270 CDD:289249 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 352 1.000 Inparanoid score I2227
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 1 1.000 - - otm25830
orthoMCL 1 0.900 - - OOG6_101382
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1020
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.