DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:232 Identity:57/232 - (24%)
Similarity:107/232 - (46%) Gaps:18/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PRAGFNFDNCKRNATLLNR--------GFKPPT-TTKTGTTIVGIIYKDGVILGADTRATEGPIV 65
            |...:||...:.....|.|        |.|..| ::.|||:::||.|..||:|.|||..:.|.:.
  Fly    19 PGEFYNFTGGQTPVQQLPRELTTMGPYGTKHSTASSTTGTSVLGIRYDSGVMLAADTLVSYGSMA 83

  Fly    66 SDKNCAKIHYLAKNIYCCGAGTAADTE-MTTDLISSQLELHRLQTDREVRVVAANTMLKQMLFRY 129
            ..:|..::..:.|||...|:|..||.: :..::....:|......:.|::..:..:.:.::|:..
  Fly    84 RYQNIERVFKVNKNILLGGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWMTRVLYNR 148

  Fly   130 QGHISAA---LVLGGVDKTG-PHIYSIHPHGSS-DKLPYATMGSGSLAAMTVFESRWKP-DLSEE 188
            :..::..   :|:||||..| |::.::...|.| :....||..:..||...|.|.:.|. |.:..
  Fly   149 RSRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLVREKKPKDRDFTAV 213

  Fly   189 EGKKLVRDAIASGVFNDLGSGS--NIDLCVIRKGSVE 223
            |..:|:|..:....:.|..:.|  .:.:|.:....||
  Fly   214 EASELIRTCMEVLYYRDTRNISQYTVGVCSVNGCGVE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 46/191 (24%)
proteasome_beta_type_7 42..228 CDD:239732 46/191 (24%)
Pr_beta_C 232..264 CDD:289249
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 46/191 (24%)
PRE1 60..232 CDD:223711 42/171 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.