DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:215 Identity:51/215 - (23%)
Similarity:88/215 - (40%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFKPPTTT---KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAAD 90
            |.|.|..:   ..|.:||.|...|..::.||||.:.|..:..:..:|:..|:.......||..||
  Fly    16 GMKHPDFSPYESNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWAD 80

  Fly    91 TEMTTDLISSQLELH-----RLQTDREVRVVAANTMLKQMLFRYQGHISAALVLGGVDKTGPH-I 149
            |...|..|..:::.:     |..|...|..:.:..|..:..|.|  ::|.  :|.|:|..|.. :
  Fly    81 TLSLTGSIKVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPY--YVSN--ILAGIDNEGKGVV 141

  Fly   150 YSIHPHGSSDKLPYATMGSGSLAAMTVFESRW-----------KPDLSEEEGKKLVRDAIASGVF 203
            ||..|.|..:|..|...|:.......|.:::.           |..|::|....:..|...|...
  Fly   142 YSYDPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAE 206

  Fly   204 NDLGSGSNIDLCVIRKGSVE 223
            .|:.:|.::.:.:|.|..:|
  Fly   207 RDIYTGDSVLINIITKDGIE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 47/199 (24%)
proteasome_beta_type_7 42..228 CDD:239732 47/199 (24%)
Pr_beta_C 232..264 CDD:289249
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 48/209 (23%)
PRE1 24..225 CDD:223711 47/204 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441194
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.