DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Psma8

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:229 Identity:55/229 - (24%)
Similarity:88/229 - (38%) Gaps:36/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQ 101
            |.|:|.|||...:.|:||.:.::. ..:..::...||..|..::....||..||..:.......:
  Rat    29 KKGSTAVGIRGTNIVVLGVEKKSV-AKLQDERTVRKICALDDHVCMAFAGLTADARVVISRARVE 92

  Fly   102 LELHRLQTDREV------RVVAANTMLKQMLFRYQGH----ISAALVLGGVDKTG-PHIYSIHPH 155
            .:.|:|..:..|      |.:|.   |||...:..|.    |||.:|  |.|..| |.:|...|.
  Rat    93 CQSHKLTVEDPVTVEYITRFIAT---LKQKYTQSNGRRPFGISALIV--GFDDDGIPRLYQTDPS 152

  Fly   156 GSSDKLPYATMGSGSLAAMTVFESRWKPDL--SEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIR 218
            |:........:|..:.......|..:..|.  ::.|..||...|:...|   ...|.||:|.:||
  Rat   153 GTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDNEAIKLAIKALLEVV---QSGGKNIELAIIR 214

  Fly   219 KGS--------------VEYLRNYELANKKGKRQ 238
            :..              .|..|..:.|.||..::
  Rat   215 RDQPLKMFSAKEIELEVTEIEREKDEAEKKKSKK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 49/216 (23%)
proteasome_beta_type_7 42..228 CDD:239732 49/212 (23%)
Pr_beta_C 232..264 CDD:289249 2/7 (29%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 50/213 (23%)
proteasome_alpha_type_7 5..213 CDD:239724 48/192 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.