DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:206 Identity:49/206 - (23%)
Similarity:95/206 - (46%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQLELH 105
            |::||...|.|:|.|||......||..::..|||.::.::.....|.:.|||..|:.||..:.|:
  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67

  Fly   106 RLQTDREVRVVAANTMLKQMLFRY---QGHISAALVLGGVD-KTGPHIYSIHPHGSSDKLPYATM 166
            :::...::....:....::.|..|   :......:.:.|.| ..||.:..|....::..:.||..
  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAGH 132

  Fly   167 GSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRKGSVEYLRNYELA 231
            |.|::.|.::::..|.|::::.|...:.:..||.                |:|..|..|:|:.:|
  Fly   133 GYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAE----------------IQKRLVVNLKNFTVA 181

  Fly   232 --NKKGKRQLD 240
              :|.|.|.|:
  Fly   182 VVDKDGVRDLE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 44/195 (23%)
proteasome_beta_type_7 42..228 CDD:239732 42/189 (22%)
Pr_beta_C 232..264 CDD:289249 4/9 (44%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 49/206 (24%)
proteasome_beta_type_2 1..192 CDD:239727 48/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441141
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.