DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Prosalpha6

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster


Alignment Length:169 Identity:45/169 - (26%)
Similarity:71/169 - (42%) Gaps:13/169 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQ 101
            |.||..||:..||..:|.|..:.|..  :||.. .||..:..::....||..||..:.:..:.|:
  Fly    30 KLGTATVGLKNKDYAVLVALCKPTSE--LSDTQ-RKIIPIDDHLGISIAGLTADARVLSRYLRSE 91

  Fly   102 L--ELHRLQTDREVRVVAAN--TMLKQMLFRYQGH-ISAALVLGGVDKTGPHIYSIHPHGSSDKL 161
            .  ..|...|...|..:..|  ..::....||... ....|::.|.|:.|||||.:.|..:....
  Fly    92 CLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDERGPHIYQVTPSATFFNC 156

  Fly   162 PYATMGSGSLAAMTVFESRWKP--DLSEEEGKKLVRDAI 198
            ...::||.|.:|.|..|.....  |.|::|   ::|..|
  Fly   157 KANSIGSRSQSARTYLEKNLNKFLDSSKDE---IIRHGI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 42/164 (26%)
proteasome_beta_type_7 42..228 CDD:239732 42/164 (26%)
Pr_beta_C 232..264 CDD:289249
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 45/169 (27%)
proteasome_alpha_type_1 6..219 CDD:239718 45/169 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441168
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.