DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:220 Identity:53/220 - (24%)
Similarity:94/220 - (42%) Gaps:32/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQLELH 105
            ||:|:...|.:||.:||...:..:..|....|.|.::.......||...|....:|.|...::|:
  Fly     3 TILGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMDLY 67

  Fly   106 RLQTDREVRVVAANTMLKQMLFRYQGHISA----------ALVLGGVDKT-GPHIYSIHPHGSSD 159
            ::....::.|..|...:::       |:||          :|::||.|.| ||.::.|...|:|.
  Fly    68 KITNGYDLTVRGAVHFIRR-------HLSAYLKSDCTFQVSLLVGGYDLTSGPELHYIDYLGNSV 125

  Fly   160 KLPYATMGSGSLAAMTVFESRWKPDLSEEEG----KKLVRDAIASGVFNDLGSGSNIDLCVIRKG 220
            .:.|...|:.......:.|..:|||:..:..    ||.|.:.....|.|    ..||||.:|.|.
  Fly   126 PVRYGGHGAAMNFCTPILEEFYKPDMDTQAAYDVIKKCVIELYKRFVIN----LRNIDLFLISKN 186

  Fly   221 SVEYLRNYELANKKG------KRQL 239
            .:..:.:..|.:.:|      ||::
  Fly   187 GITKMNSINLESLRGDILAGPKRRI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 49/204 (24%)
proteasome_beta_type_7 42..228 CDD:239732 48/200 (24%)
Pr_beta_C 232..264 CDD:289249 3/14 (21%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 51/211 (24%)
proteasome_beta_type_2 1..193 CDD:239727 49/200 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441135
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.