DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Prosalpha4

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster


Alignment Length:227 Identity:48/227 - (21%)
Similarity:91/227 - (40%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQ 101
            :.|:|.||:...:.|:||.:.::. ..:..|:...||..|..::....||..||..:..:....:
  Fly    29 RKGSTAVGVRGANCVVLGVEKKSV-AQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVE 92

  Fly   102 LELHRLQTDREV------RVVAANTMLKQMLFRYQGH--ISAALVLGGVDKTG-PHIYSIHPHGS 157
            .:.|||..:..|      |.:|   .|||...:..|.  ...:.::||.|..| .|::...|.|.
  Fly    93 CQSHRLNVEDPVTLEYITRFIA---QLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGI 154

  Fly   158 SDKLPYATMGSGSLAAMTVFESRWK-PDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRKGS 221
            ..:......|..:......||..:: .:::.|.|  .|:.||.:.:.......:|:::.::..|.
  Fly   155 FYEYKANATGRSAKVVREFFEKSYREEEVANEHG--AVKLAIRALLEVAQSGQNNLEVAIMENGK 217

  Fly   222 ----------------VEYLRNYELANKKGKR 237
                            :|..:..||..||.|:
  Fly   218 PLKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 43/215 (20%)
proteasome_beta_type_7 42..228 CDD:239732 41/211 (19%)
Pr_beta_C 232..264 CDD:289249 3/6 (50%)
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 42/207 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 41/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441105
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.