Sequence 1: | NP_524076.2 | Gene: | Prosbeta2 / 39628 | FlyBaseID: | FBgn0023174 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571467.3 | Gene: | psmb8a / 30666 | ZFINID: | ZDB-GENE-990415-141 | Length: | 271 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 67/272 - (24%) |
---|---|---|---|
Similarity: | 126/272 - (46%) | Gaps: | 46/272 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 AGFNFDNCKR---NATLLNR-----------------GFKPPTTTKT-------------GTTIV 43
Fly 44 GIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCG--AGTAADTEMTTDLISSQLELHR 106
Fly 107 LQTDREVRVVAANTMLKQMLFRYQG-HISAALVLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGS 170
Fly 171 LAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRK-GSVEYLRNYELANKK 234
Fly 235 GKRQLDYRFKTG 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta2 | NP_524076.2 | PRE1 | 42..232 | CDD:223711 | 51/193 (26%) |
proteasome_beta_type_7 | 42..228 | CDD:239732 | 51/189 (27%) | ||
Pr_beta_C | 232..264 | CDD:289249 | 5/15 (33%) | ||
psmb8a | NP_571467.3 | PTZ00488 | 37..266 | CDD:185666 | 59/237 (25%) |
proteasome_beta_type_5 | 68..255 | CDD:239730 | 53/188 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |