DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and psmb8a

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_571467.3 Gene:psmb8a / 30666 ZFINID:ZDB-GENE-990415-141 Length:271 Species:Danio rerio


Alignment Length:272 Identity:67/272 - (24%)
Similarity:126/272 - (46%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AGFNFDNCKR---NATLLNR-----------------GFKPPTTTKT-------------GTTIV 43
            :|:.:::..:   ..|||:|                 |..|....|:             |||.:
Zfish     7 SGYKYNSASQFGFKQTLLDRSNHYSFGTKCQEFAVPVGVDPSKFLKSCSCEDGVCIDLNHGTTTL 71

  Fly    44 GIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCG--AGTAADTEMTTDLISSQLELHR 106
            ...::.|||:..|:||:.|..::.|...|:  :..|.|..|  :|:|||.:....|::.:..|::
Zfish    72 AFKFRHGVIVAVDSRASAGKYIASKEANKV--IEINPYLLGTMSGSAADCQYWERLLAKECRLYK 134

  Fly   107 LQTDREVRVVAANTMLKQMLFRYQG-HISAALVLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGS 170
            |:..:.:.|.||:.:|..|:..|:| .:|...::.|.||.||.:|.:..:|:.......:.|.|:
Zfish   135 LRNKQRISVSAASKLLSNMMLGYRGMGLSMGSMICGWDKQGPGLYYVDDNGTRLSGRMFSTGCGN 199

  Fly   171 LAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRK-GSVEYLRNYELANKK 234
            ..|..|.:|.::.|::.||..:|.|..||.....|..||..::|..::: |.::..       |:
Zfish   200 SYAYGVVDSGYREDMTVEEAYELGRRGIAHATHRDAYSGGVVNLYHMQEDGWIKVC-------KE 257

  Fly   235 GKRQLDYRFKTG 246
            ...:|.:|:|.|
Zfish   258 DVSELIHRYKKG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 51/193 (26%)
proteasome_beta_type_7 42..228 CDD:239732 51/189 (27%)
Pr_beta_C 232..264 CDD:289249 5/15 (33%)
psmb8aNP_571467.3 PTZ00488 37..266 CDD:185666 59/237 (25%)
proteasome_beta_type_5 68..255 CDD:239730 53/188 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.