DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Psmb2

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_058980.1 Gene:Psmb2 / 29675 RGDID:61874 Length:201 Species:Rattus norvegicus


Alignment Length:163 Identity:37/163 - (22%)
Similarity:76/163 - (46%) Gaps:8/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQLELHR 106
            ::||...|.|::.:|..|....:....:..|:..:::.|.....|.|.||....:.|...::|::
  Rat     4 LIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYK 68

  Fly   107 LQTDREVRVVAANTMLKQML-----FRYQGHISAALVLGGVDK-TGPHIYSIHPHGSSDKLPYAT 165
            ::...|:...||....::.|     .|...|::  |:|.|.|: .||.:|.:....:..|.|:|.
  Rat    69 MRNGYELSPTAAANFTRRNLADCLRSRTPYHVN--LLLAGYDEHEGPALYYMDYLAALAKAPFAA 131

  Fly   166 MGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAI 198
            .|.|:...:::.:..:.|.:|.|...:|:|..:
  Rat   132 HGYGAFLTLSILDRYYTPTISRERAVELLRKCL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 37/163 (23%)
proteasome_beta_type_7 42..228 CDD:239732 37/163 (23%)
Pr_beta_C 232..264 CDD:289249
Psmb2NP_058980.1 proteasome_beta_type_2 1..192 CDD:239727 37/163 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.