DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and pas-1

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_506571.1 Gene:pas-1 / 179941 WormBaseID:WBGene00003922 Length:246 Species:Caenorhabditis elegans


Alignment Length:267 Identity:51/267 - (19%)
Similarity:105/267 - (39%) Gaps:73/267 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AGFNFDNCKRNATLLNRGFKP-----------PTTTKTGTTIVGIIYKDGVILGADTRATEGPIV 65
            |||:     |:.|:    |.|           .....|..|.|.:...|..::....|..:..||
 Worm     7 AGFD-----RHITI----FSPEGRVYQVEYAFKAINSTNLTAVAVKGADAAVIAVQKRVPDSLIV 62

  Fly    66 SDKNCAKIHYLAKNIYCCGAGTAADT--------------------EMTTDLISSQL-ELHRLQT 109
            :| ....::.:::::.||..|...|.                    :|..:|::.:: :|::..|
 Worm    63 AD-TVTSVYQISQSVGCCAIGMIPDAKFQIKRAQGEAASWKYKNGYDMPCELLAKKMADLNQYYT 126

  Fly   110 -DREVRVVAANTMLKQMLFRYQGHISAALVLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGSLAA 173
             :.|:|.:..                |.|.:...|:.||.:|.:.|.|....:...::|...|.|
 Worm   127 QNAEMRSLGC----------------ALLFISYDDEKGPEVYRVDPAGYYRGMKGVSVGVKQLPA 175

  Fly   174 MTVFES--RWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRKGS----------VEYLR 226
            .:..|.  :.|.:|:..|..:|..:|:.:.:..|:.| .::::.|:.|.:          ||:..
 Worm   176 TSFLEKKIKKKSELTSTEAIELAIEALQTSLGIDVRS-KDLEVVVVTKDNSKFTKLTSDQVEHHL 239

  Fly   227 NYELANK 233
            | ::||:
 Worm   240 N-QIANR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 40/223 (18%)
proteasome_beta_type_7 42..228 CDD:239732 39/219 (18%)
Pr_beta_C 232..264 CDD:289249 1/2 (50%)
pas-1NP_506571.1 PRE1 7..245 CDD:223711 50/265 (19%)
proteasome_alpha_type_6 8..220 CDD:239723 43/238 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.