DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and pbs-6

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_498806.1 Gene:pbs-6 / 176161 WormBaseID:WBGene00003952 Length:258 Species:Caenorhabditis elegans


Alignment Length:210 Identity:47/210 - (22%)
Similarity:96/210 - (45%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PTTTKTGTTIVGIIYKDGVILGADTRATEGPI-VSDKNCAKIHYLAKNIYCCGAGTAADTEMTTD 96
            |.:.:.|:| ..|..::..|:.:|||.|:..| :..::..||..|..||....:|...|......
 Worm    46 PYSMEGGST-CAISGENFAIVASDTRMTQNDINILTRDAEKIQILNDNIILTTSGFYGDVLQLKK 109

  Fly    97 LISSQLELHRLQTDREVRVVAANTMLKQMLF--RYQGHISAALVLGGVDKTGP-HIYSIHPHGSS 158
            ::.|:|..:|.....::.|.....:|.:.|:  |:..:.:.| :|.|:|:.|. .::|..|.|..
 Worm   110 VLQSRLHKYRFDYRSDMSVDLCAELLSRNLYYRRFFPYYTGA-ILAGIDEHGKGAVFSYDPIGCI 173

  Fly   159 DKLPYATMGSG----------SLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNID 213
            ::|.|:..|:.          .:..:|:.|...:|:|:.:....|::|:.......::.:|..|.
 Worm   174 ERLGYSASGAAEPMIIPFLDCQIGHVTLSEGYERPELTLDRAISLMKDSFRGAAEREISTGDKIH 238

  Fly   214 LCVIRKGS---VEYL 225
            |.:...|.   |::|
 Worm   239 LVIAEAGKPVVVKFL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 44/201 (22%)
proteasome_beta_type_7 42..228 CDD:239732 44/201 (22%)
Pr_beta_C 232..264 CDD:289249
pbs-6NP_498806.1 PRE1 38..246 CDD:223711 44/201 (22%)
Ntn_hydrolase 44..258 CDD:294319 47/210 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.