Sequence 1: | NP_524076.2 | Gene: | Prosbeta2 / 39628 | FlyBaseID: | FBgn0023174 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498806.1 | Gene: | pbs-6 / 176161 | WormBaseID: | WBGene00003952 | Length: | 258 | Species: | Caenorhabditis elegans |
Alignment Length: | 210 | Identity: | 47/210 - (22%) |
---|---|---|---|
Similarity: | 96/210 - (45%) | Gaps: | 19/210 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 PTTTKTGTTIVGIIYKDGVILGADTRATEGPI-VSDKNCAKIHYLAKNIYCCGAGTAADTEMTTD 96
Fly 97 LISSQLELHRLQTDREVRVVAANTMLKQMLF--RYQGHISAALVLGGVDKTGP-HIYSIHPHGSS 158
Fly 159 DKLPYATMGSG----------SLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNID 213
Fly 214 LCVIRKGS---VEYL 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta2 | NP_524076.2 | PRE1 | 42..232 | CDD:223711 | 44/201 (22%) |
proteasome_beta_type_7 | 42..228 | CDD:239732 | 44/201 (22%) | ||
Pr_beta_C | 232..264 | CDD:289249 | |||
pbs-6 | NP_498806.1 | PRE1 | 38..246 | CDD:223711 | 44/201 (22%) |
Ntn_hydrolase | 44..258 | CDD:294319 | 47/210 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |