DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and pbs-5

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_493558.1 Gene:pbs-5 / 173334 WormBaseID:WBGene00003951 Length:284 Species:Caenorhabditis elegans


Alignment Length:262 Identity:75/262 - (28%)
Similarity:119/262 - (45%) Gaps:41/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RAGFNFDNCKRNATLLNRGFKPPTTTKT--------------GTTIVGIIY-------KDGVILG 54
            ||.|.|       ..|..|.:|....||              |||.:..:|       |.|:|:.
 Worm    29 RADFTF-------AKLPLGIQPVDFMKTHFAETAGKSMQFRKGTTTLAFVYEPATPADKGGIIVA 86

  Fly    55 ADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQLELHRLQTDREVRVVAAN 119
            .|:||:.|..:|.|:..||..:...:....||.|||.:..|.:::....|:.|:....:.|.||:
 Worm    87 VDSRASSGEYISSKSVMKILDIGDRMVATMAGGAADCQFWTRIVAKYCTLYELREKTSITVSAAS 151

  Fly   120 TMLKQMLFRYQGH-ISAALVLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKP 183
            ......|:.|:|. :|...::.|.||.||.|:.:...|...:|...::|||||.|..:.::.:||
 Worm   152 KYFANTLYGYRGQGLSVGSMVAGYDKKGPQIFKVDSEGDRCQLKVCSVGSGSLNAYGILDNHYKP 216

  Fly   184 DLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRKGSVEYLRN---------YELANKKGKRQL 239
            .::::|.:||...||....:.|.|||...:||.|.  ..|.:|.         ||.|::.| |.:
 Worm   217 KMTDDEARKLGLRAIMHATYRDSGSGGVCNLCHIT--PTEKIRLPPMDVSKLWYEFADELG-RDI 278

  Fly   240 DY 241
            .|
 Worm   279 TY 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 59/206 (29%)
proteasome_beta_type_7 42..228 CDD:239732 57/202 (28%)
Pr_beta_C 232..264 CDD:289249 3/10 (30%)
pbs-5NP_493558.1 Ntn_hydrolase 65..252 CDD:320988 57/188 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.