DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and psma6a

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_705941.2 Gene:psma6a / 171585 ZFINID:ZDB-GENE-020326-1 Length:246 Species:Danio rerio


Alignment Length:181 Identity:39/181 - (21%)
Similarity:59/181 - (32%) Gaps:46/181 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LNRGFKPPTTTKTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAAD 90
            :|:|         |.|.|.:..||..:: ...|.....::.......:..:.:||.|..:|..||
Zfish    32 INQG---------GLTSVAVRGKDCAVV-ITQRKVPDKLLDSSTVTHLFRITENIGCVMSGMTAD 86

  Fly    91 TEMTTDLISSQLELHRLQTDREVRVVAANTMLK-------QMLFRYQGHIS-------------A 135
            :              |.|..| .|..|||...|       .||.:....||             .
Zfish    87 S--------------RSQVQR-ARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGC 136

  Fly   136 ALVLGGVD-KTGPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDL 185
            .:::.||| :.||.:|...|.|..........|.....|.:..|.:.|..|
Zfish   137 CMIVVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKIKKKL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 35/165 (21%)
proteasome_beta_type_7 42..228 CDD:239732 35/165 (21%)
Pr_beta_C 232..264 CDD:289249
psma6aNP_705941.2 PRK03996 6..239 CDD:235192 39/181 (22%)
proteasome_alpha_type_6 8..220 CDD:239723 39/181 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.