DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and Psmb8

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_034854.2 Gene:Psmb8 / 16913 MGIID:1346527 Length:276 Species:Mus musculus


Alignment Length:207 Identity:61/207 - (29%)
Similarity:100/207 - (48%) Gaps:20/207 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LNRGFKPPTTTKT---------------GTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHY 75
            |.||.:|....::               |||.:...::.|||:..|:|||.|..:|.....|:  
Mouse    44 LPRGMQPTAFLRSFGGDQERNVQIEMAHGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKV-- 106

  Fly    76 LAKNIYCCG--AGTAADTEMTTDLISSQLELHRLQTDREVRVVAANTMLKQMLFRYQG-HISAAL 137
            :..|.|..|  :|.|||.:....|::.:..|:.|:....:.|.||:.:|..|:.:|:| .:|...
Mouse   107 IEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGS 171

  Fly   138 VLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGV 202
            ::.|.||.||.:|.:..:|:.......:.|||:..|..|.:|.::.|||.||...|.|.|||...
Mouse   172 MICGWDKKGPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLGRRAIAYAT 236

  Fly   203 FNDLGSGSNIDL 214
            ..|..||..:::
Mouse   237 HRDNYSGGVVNM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 54/176 (31%)
proteasome_beta_type_7 42..228 CDD:239732 54/176 (31%)
Pr_beta_C 232..264 CDD:289249
Psmb8NP_034854.2 PTZ00488 40..271 CDD:185666 61/207 (29%)
proteasome_beta_type_5 73..260 CDD:239730 56/178 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.