Sequence 1: | NP_524076.2 | Gene: | Prosbeta2 / 39628 | FlyBaseID: | FBgn0023174 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034854.2 | Gene: | Psmb8 / 16913 | MGIID: | 1346527 | Length: | 276 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 61/207 - (29%) |
---|---|---|---|
Similarity: | 100/207 - (48%) | Gaps: | 20/207 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LNRGFKPPTTTKT---------------GTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHY 75
Fly 76 LAKNIYCCG--AGTAADTEMTTDLISSQLELHRLQTDREVRVVAANTMLKQMLFRYQG-HISAAL 137
Fly 138 VLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGV 202
Fly 203 FNDLGSGSNIDL 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta2 | NP_524076.2 | PRE1 | 42..232 | CDD:223711 | 54/176 (31%) |
proteasome_beta_type_7 | 42..228 | CDD:239732 | 54/176 (31%) | ||
Pr_beta_C | 232..264 | CDD:289249 | |||
Psmb8 | NP_034854.2 | PTZ00488 | 40..271 | CDD:185666 | 61/207 (29%) |
proteasome_beta_type_5 | 73..260 | CDD:239730 | 56/178 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |