DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2 and psmb7.2

DIOPT Version :9

Sequence 1:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002941310.2 Gene:psmb7.2 / 100489016 XenbaseID:XB-GENE-479691 Length:279 Species:Xenopus tropicalis


Alignment Length:268 Identity:143/268 - (53%)
Similarity:185/268 - (69%) Gaps:5/268 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PRAGFNFDNCKRNATLLNR----GFKPPTTTKTGTTIVGIIYKDGVILGADTRATEGPIVSDKNC 70
            |..||:|:||.||..|..:    |.:||...||||||.|||||||||||||.|||:..:|:||||
 Frog    11 PCGGFSFENCPRNTFLEEQGPKLGLQPPKARKTGTTIAGIIYKDGVILGADRRATDDMVVADKNC 75

  Fly    71 AKIHYLAKNIYCCGAGTAADTEMTTDLISSQLELHRLQTDREVRVVAANTMLKQMLFRYQGHISA 135
            |||||:..||||||||.|||.|..|.|:||.|.:|.:.|.|:.||..||.:|||.|:||||||.|
 Frog    76 AKIHYITDNIYCCGAGVAADAENVTQLLSSNLHIHAMTTGRQPRVCTANRILKQFLYRYQGHIGA 140

  Fly   136 ALVLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIAS 200
            ::::||||..||.:|||:||||:|::|:..:||||.||:.|.|.|:||::..||||:||.:||.:
 Frog   141 SIIVGGVDIKGPQLYSIYPHGSTDRVPFTALGSGSAAAIAVLEDRFKPNMELEEGKRLVTEAITA 205

  Fly   201 GVFNDLGSGSNIDLCVIRKGSVEYLRNYELANKKGKRQLDYRFKTGTSTVLHTNIKDL-LVTERV 264
            |:..||||||.:|||:|.|.....||.:.....:||:...||:..||:.||...|..| ||.|.|
 Frog   206 GIMCDLGSGSGVDLCIITKEEARILRGHTTTETRGKKMASYRYARGTTPVLGETITRLELVEESV 270

  Fly   265 QAVPMEIS 272
            |.:..:.|
 Frog   271 QIMETDES 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 110/189 (58%)
proteasome_beta_type_7 42..228 CDD:239732 110/185 (59%)
Pr_beta_C 232..264 CDD:289249 13/32 (41%)
psmb7.2XP_002941310.2 proteasome_beta_type_7 45..233 CDD:239732 112/187 (60%)
Pr_beta_C 239..270 CDD:372128 13/30 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1020
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.