DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip71B and ZIP3

DIOPT Version :9

Sequence 1:NP_001097608.1 Gene:Zip71B / 39626 FlyBaseID:FBgn0036461 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_180786.1 Gene:ZIP3 / 817787 AraportID:AT2G32270 Length:339 Species:Arabidopsis thaliana


Alignment Length:333 Identity:68/333 - (20%)
Similarity:120/333 - (36%) Gaps:68/333 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 IYASITMLILSACGLLGILLVPLMKSAAYQEILKFLV-SIAVGTLAGDALMHLLPHA-------L 300
            |.|..|:||....|:|..||..:..|...:....|:. :.|.|.:.....||:||.|       .
plant    55 IAAIPTVLIAGIIGVLFPLLGKVFPSLRPETCFFFVTKAFAAGVILATGFMHVLPEAYEMLNSPC 119

  Fly   301 FKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPLLKGGKPGHGHSHGHGH 365
            ...|..|...||.                  ...:||:....::....                .
plant   120 LTSEAWEFPFTGF------------------IAMIAAILTLSVDTFAT----------------S 150

  Fly   366 SHGRSHGHMEKPAAKDAIDLPPPRELNVMLQEAKLD-EKTPDRPLTPVAFMVIIGDGLHNLTDGL 429
            |..:||....|            |..:....|:.:| ||........:|.::.:|..:|::..|:
plant   151 SFYKSHCKASK------------RVSDGETGESSVDSEKVQILRTRVIAQVLELGIIVHSVVIGI 203

  Fly   430 AIGAAFASDPVTGFATAFAVLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLF 494
            ::||  :..|....|...|::.|:....||....:.|..........|:...::.:.:|:.||:.
plant   204 SLGA--SQSPDAAKALFIALMFHQCFEGLGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMG 266

  Fly   495 IAGIGDGMTQW-------IYAATAGSFLYIAFADLVPTMSVAHNPEKAKDPKGI-IIQIFGILLG 551
            ||...|..:..       :.||:||..:|::..||   ::......|.:...|: |:....:|||
plant   267 IANSYDESSPTALIVQGVLNAASAGILIYMSLVDL---LAADFTHPKMQSNTGLQIMAHIALLLG 328

  Fly   552 GLIMLAIA 559
            ..:|..:|
plant   329 AGLMSLLA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip71BNP_001097608.1 Zip 242..559 CDD:280666 67/331 (20%)
ZIP3NP_180786.1 zip 38..339 CDD:273287 68/333 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.