DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mnd and CG13248

DIOPT Version :9

Sequence 1:NP_524074.1 Gene:mnd / 39625 FlyBaseID:FBgn0002778 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_649219.1 Gene:CG13248 / 40254 FlyBaseID:FBgn0036984 Length:669 Species:Drosophila melanogaster


Alignment Length:455 Identity:112/455 - (24%)
Similarity:198/455 - (43%) Gaps:85/455 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IPRQVFEVPPAEPNNSTADSGSQGSGVKLKKQIGLLDGVAIIVGVIVGSGIFVSPKGVLKFSGSI 75
            :|..|.|.|                   |.:.:...|...:.:|.:||:||:|....|.|.....
  Fly    26 VPTDVMETP-------------------LNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGP 71

  Fly    76 GQSLIVWVLSGVLSMVGALCYAELGTMIPKSGGDYAYIGTAFGPLPAFLYLWVALL--ILVPT-- 136
            | .::.::|:|.:||:.||||||.||.:||:|..|.|...:.|...||:..|..||  :|...  
  Fly    72 G-IILSFILAGFISMLAALCYAEFGTRVPKAGSAYVYTYISMGEFWAFVIGWNILLEHMLGAASV 135

  Fly   137 ----------------GNAITALTFAIYLLKPFWPSCDAPIEAVQLLAAAMICVLTLINCY---- 181
                            ||....||..|:         :..:.....:.|.::|::     |    
  Fly   136 ARAWSGYVDSMLGGWIGNTTLELTGGIH---------EPGLAQYPDVLAFLVCIV-----YAAAL 186

  Fly   182 --NVKWVTRVTDIFTGTKVVALLVIVGAGVWWLFDGNTEHWDN------PFSGGLQDPGYIALA- 237
              .||.......:.|...:..:::::..|.|:. ||  ::|..      |:..|    |.||.| 
  Fly   187 AGGVKATAVFNSLLTLVNIAVMVLVISVGFWYA-DG--KNWSEAEGGFLPYGVG----GVIAGAA 244

  Fly   238 --FYSGLFSYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPDEILSSD 300
              ||    ::.|::.:....||.|:|..::|.|..||:.||||.|::.:.|...::...||..:.
  Fly   245 TCFY----AFVGFDSIATSGEEAKNPSVSIPVATVISLFVVTVGYILVSAALTLMIPISEINPAA 305

  Fly   301 AVAVTFGDKMLGYMSWIMPFAVACSTFGSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLTPV 365
            ::...||...|.:..:::.....|....:|.|::||..|..:..|.:|.|.:....||.....|:
  Fly   306 SLPEAFGQLNLSWAKYLISIGALCGMTTTLLGSLFALPRCMYAMASDGLLFSCFGKINPTTQVPL 370

  Fly   366 PSLIFLGVLTLLLLFIEDVYVLINYVSYVEAL-FTLISVSGLLWMRYKQPKTERPIKVNLALPII 429
            .:|:..||::..|..:.|:..|:.::|....| :|::|.|.:: :||:  ..|| |...:.:|.:
  Fly   371 LNLVVSGVMSACLALVFDLAKLVEFMSIGTLLAYTIVSASVII-LRYR--PMER-IHTTIRVPAV 431

  Fly   430  429
              Fly   432  431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mndNP_524074.1 2A0308 22..496 CDD:273332 108/444 (24%)
CG13248NP_649219.1 2A0303 32..603 CDD:273330 110/449 (24%)
AA_permease_C 551..601 CDD:290617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.