DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mnd and SPAPB24D3.02c

DIOPT Version :9

Sequence 1:NP_524074.1 Gene:mnd / 39625 FlyBaseID:FBgn0002778 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_593989.1 Gene:SPAPB24D3.02c / 2543419 PomBaseID:SPAPB24D3.02c Length:543 Species:Schizosaccharomyces pombe


Alignment Length:521 Identity:118/521 - (22%)
Similarity:199/521 - (38%) Gaps:134/521 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KLKKQIGLLDGVAIIVGVIVGS-GIFVSPKGVLKFSGSIGQSLIVWVLSGVLSMVGALC------ 95
            :.|::..||    .:.|...|| |:..|..|.:.||.:.|...:||..     .|||.|      
pombe    42 EFKREFSLL----AVFGQSFGSMGLCPSLVGSMAFSMNCGAGGMVWSW-----FVGATCLLPIAF 97

  Fly    96 -YAELGTMIPKSGGDYAYIGTAFGPLP---AFL--YLWVALLILVPTGNAITALTFA------IY 148
             .:||.:.:|.||.  .|..||:...|   |||  :|...|.:...||.|.|....|      ..
pombe    98 ALSELASSMPTSGS--LYFWTAYLSPPKYRAFLSWFLGYVLALAYSTGFASTIYAAAGLVQATAS 160

  Fly   149 LLKPFWPSCDAPIE--------AVQLLAAAMICVLTLINCYNVKWVTRVTDIFTGTKVVALLVIV 205
            :..|.:    ||.:        |:....:|:|.:.|       |::.|.:......::..:|:.:
pombe   161 VANPSY----APTKYEEYGIYVALSFACSALIVLPT-------KFLARFSSFNVVFQICTILIFI 214

  Fly   206 --------------GAGVWWLFDGNTEHWDNPFSGGLQDPGY-IALAFYSGLFSYSGWNYLNFVT 255
                          |:.::    ||.|::     .|..:.|: ..|.|.:.::..||:.....:.
pombe   215 ISLAASSTSETRNTGSYIF----GNFENY-----SGWTNMGWSFILCFTTPVWVLSGFESCATIV 270

  Fly   256 EELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPD--EILS-------SDAVAVTFGDKML 311
            ||.|:..:..|.||..|:.|...:.....|.....:..|  .||:       |..:....|.:..
pombe   271 EEAKNASKAAPIAIISSLTVSLFMGFCIMITIAGTMGHDFSSILNTPYGEPVSQVLYNNLGKRGA 335

  Fly   312 GYMSWIMPFAVA--CSTFGSLNGAIFASSRLFFVGARNGHLPA---------------AISLINV 359
            ..:|.::..|:.  ||..      ..||||..|..||:..||.               ||.|:|:
pombe   336 VGVSAVLIIALCFNCSAL------CLASSREIFAFARDKGLPGSWIFRKLTPGGIPLNAILLVNL 394

  Fly   360 NCLTPVPSLIFLGVLTLLLLFIEDVYVLINYVSYVEALFTLISVSGLLWMR-----YKQPKTERP 419
            ..:. |..|:.:.|..:..:|  ::.::..::||     :|..|..||:.|     :...|..:|
pombe   395 YTII-VGLLMLVNVTAISSIF--NLAIIAFFISY-----SLPLVCRLLFNRLNPGKFYCGKFSKP 451

  Fly   420 IKVNLALPIIYLIVCLFLVIFSCTQTPYVVGIGTIIILSGIPV------YYL------TIHK-PV 471
            |.:   :.:.:|.....:::|...|.|..|.:...|::.|..|      |||      |..| ||
pombe   452 ISI---VAVAWLWFMALMLLFPSYQNPNKVEMNWAIVVLGFTVFFCVGYYYLPKYGGKTFFKGPV 513

  Fly   472 K 472
            |
pombe   514 K 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mndNP_524074.1 2A0308 22..496 CDD:273332 118/521 (23%)
SPAPB24D3.02cNP_593989.1 2A0304 34..512 CDD:273331 115/517 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I1915
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.