DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mnd and SPCC584.13

DIOPT Version :9

Sequence 1:NP_524074.1 Gene:mnd / 39625 FlyBaseID:FBgn0002778 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_588218.1 Gene:SPCC584.13 / 2539095 PomBaseID:SPCC584.13 Length:544 Species:Schizosaccharomyces pombe


Alignment Length:461 Identity:107/461 - (23%)
Similarity:194/461 - (42%) Gaps:83/461 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARVQASDSLIPRQVFEVPPAEPNNSTADSGSQGSGVKLKKQIGLLDGVAIIVGVIVGSGIFVSP 65
            |:..:.|.:..|.|..:|....  :..||..:.|...:.|::........:...|:   |:..|.
pombe     1 MSIFKKSSNTAPSQHEDVEALA--SDEADLAALGYKQEFKREFSAWTSFCVSFSVL---GLLPSF 60

  Fly    66 KGVLKF-SGSIGQSLIVWVLSGVLSMVGALC----YAELGTMIPKSGGDYAYIGT-----AFGPL 120
            ...:.: :|..|...:||  ..:::||...|    .|||.:.:|.|||.| |...     .:||.
pombe    61 ASTMYYTTGYAGTPAMVW--GWLIAMVFVQCVANGMAELCSSMPTSGGLY-YAAAVLAPKGWGPF 122

  Fly   121 PAFLYLWVALLILVPTGNAITALTFA---IYLLKPFWPSCDAPIEAVQLLA-AAMIC-------- 173
            .|:|..|...|:.| ||....|.:||   :.|::...|:.:.....:.||| ||||.        
pombe   123 AAWLTGWSNYLVQV-TGPPSVAYSFAGMILTLVQLHNPNFETQNYQIFLLAVAAMIAQGFISSMP 186

  Fly   174 --VLTLINCYNVKWVTRVTDIFTGTKVVALLVIVGA----------GVWWLFDGNTEHWDNPFSG 226
              ||.:.|    .|.|.:..:|....::.:|.:.|.          .||..||..|: |.|    
pombe   187 TKVLAVFN----TWGTVLNMLFLAIVMITVLAVAGTKTPRGFNSNHKVWNEFDNQTD-WSN---- 242

  Fly   227 GLQDPGYIALAFYSG-LFSYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITN--IAYF 288
                 |...|..::| :::.||::....::||..:.....|:||.::.....::..:.|  ||| 
pombe   243 -----GMAMLMSFAGVIWTMSGYDSPFHLSEECSNASVAAPRAIVMTSAFGGIVGWLLNLCIAY- 301

  Fly   289 SVLSPDEILSSDAVAVTFGDKMLGYMSWIMPF---------AVACSTFGSLNGAIFASSRLFFVG 344
            :::..:..::.|     .|...:.|:..:..:         .|.|| |....|.:.|:||:.:..
pombe   302 TIVDVNAAMNDD-----LGQPFVVYLRQVCNYKTTVALTSLTVICS-FMMGQGCMVAASRVTYSY 360

  Fly   345 ARNGHLPAAISLINVNCLTPVPSL-----IFLGVLTLLLLFIEDVYVLINYVSYVEALFTLISVS 404
            ||:|..|.:..|..|:..|..|::     :.:|:|..||:|..:  ..||.:..|.|:...::.:
pombe   361 ARDGVFPFSKYLAIVDKRTKTPNVCVWMNVVVGILCCLLIFAGE--AAINAIFSVGAIAAFVAFT 423

  Fly   405 GLLWMR 410
            ..:::|
pombe   424 TPIFLR 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mndNP_524074.1 2A0308 22..496 CDD:273332 102/440 (23%)
SPCC584.13NP_588218.1 2A0304 28..511 CDD:273331 100/432 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I1915
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.