DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mnd and LOC100150834

DIOPT Version :9

Sequence 1:NP_524074.1 Gene:mnd / 39625 FlyBaseID:FBgn0002778 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_021322470.1 Gene:LOC100150834 / 100150834 -ID:- Length:230 Species:Danio rerio


Alignment Length:216 Identity:108/216 - (50%)
Similarity:151/216 - (69%) Gaps:4/216 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 RNLPKAICISMPVVTVIYMITNIAYFSVLSPDEILSSDAVAVTFGDKMLGYMSWIMPFAVACSTF 327
            ||||.||.:|||:||:||::||:||::||.....:.|||||||||:::||.::||:|.|||.|.:
Zfish     8 RNLPIAIAVSMPIVTIIYLLTNVAYYAVLDMPSFMGSDAVAVTFGNQVLGPINWIVPIAVAMSCY 72

  Fly   328 GSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLTPVPSLIFLGVLTLLLLFIEDVYVLINYVS 392
            |.||.:|.|:|||||||||.||||.::|||:....||||:|:|..|:.|:.|.:|||:.||||.|
Zfish    73 GGLNASIIAASRLFFVGAREGHLPISLSLIHTERYTPVPALLFNCVMGLVFLCVEDVFQLINYFS 137

  Fly   393 YVEALFTLISVSGLLWMRYKQPKTERPIKVNLALPIIYLIVCLFLVIFSCTQTPYVVGIGTIIIL 457
            :...||..:||:||:::|..||...||:|::|..|.:|.:..:||||...........||..|.|
Zfish   138 FSYWLFVGLSVAGLIYLRITQPDRHRPVKLSLFFPFVYCLCSVFLVIVPLYSDTINSLIGIAIAL 202

  Fly   458 SGIPVYYLTIHKP----VKWL 474
            ||:|||||.::.|    .||:
Zfish   203 SGVPVYYLCVYLPKEKRPKWI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mndNP_524074.1 2A0308 22..496 CDD:273332 108/216 (50%)
LOC100150834XP_021322470.1 AA_permease_2 <8..223 CDD:330980 107/214 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D621852at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.