DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and SWD3

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_009734.1 Gene:SWD3 / 852472 SGDID:S000000379 Length:315 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:63/259 - (24%)
Similarity:101/259 - (38%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DRERIAAITDEATV-----------TFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVWETSTGDV 120
            |.:.||..:|:.:|           ||..|||||.:.:.:...|...|.|.|:...:|:|..|.:
Yeast    66 DGQCIATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSL 130

  Fly   121 LYEITEHKDTVTETHF-SHDGVYLATGDLAGDLFVFKVSEKHDERPI-LTKIW--EYSMSDMSWL 181
            :..|:.|.:.|..... .:|...|::|...|.:.:|.....|..:.: ..|.|  |..:..:|.:
Yeast   131 MKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQV 195

  Fly   182 FWHRAAHILLAGSDSGEVFVFRIPSGECKILPGQSSRCESGEL------------SGDGKKLFTA 234
            .:...|..||..|..|.|.::....| |.:...|....|.|.|            .|....:.:.
Yeast   196 KFSENARYLLVKSLDGVVKIWDCIGG-CVVRTFQVQPLEKGVLHHSCGMDFLNPEDGSTPLVISG 259

  Fly   235 YVNGSVKLW--DLKSCQVLID---VNESHPM----GFGEITHAVVACERESPFYVCAEA-SGEC 288
            |.||.:..|  |.||...|:|   .:.|.|:    .||.|              :|:.| :|:|
Yeast   260 YENGDIYCWNSDTKSLLQLLDGSLYHHSSPVMSIHCFGNI--------------MCSLALNGDC 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 59/247 (24%)
WD40 <81..441 CDD:225201 58/234 (25%)
WD40 repeat 89..126 CDD:293791 9/36 (25%)
WD40 repeat 132..170 CDD:293791 6/39 (15%)
WD40 repeat 175..213 CDD:293791 9/37 (24%)
WD40 repeat 220..299 CDD:293791 22/91 (24%)
WD40 repeat 266..321 CDD:293791 4/24 (17%)
WD40 repeat 326..365 CDD:293791
WD40 repeat 373..408 CDD:293791
WD40 repeat 414..438 CDD:293791
SWD3NP_009734.1 WD40 17..314 CDD:238121 63/259 (24%)
WD40 repeat 17..53 CDD:293791
WD40 repeat 59..94 CDD:293791 7/27 (26%)
WD40 repeat 99..135 CDD:293791 8/35 (23%)
WD40 repeat 142..178 CDD:293791 6/35 (17%)
WD40 repeat 192..228 CDD:293791 9/36 (25%)
WD40 repeat 236..284 CDD:293791 11/47 (23%)
WD40 repeat 290..312 CDD:293791 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.