DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and DWA3

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_176316.4 Gene:DWA3 / 842414 AraportID:AT1G61210 Length:1181 Species:Arabidopsis thaliana


Alignment Length:458 Identity:83/458 - (18%)
Similarity:141/458 - (30%) Gaps:134/458 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 MAGGDDDEEEDEEELRDRERIAAITDEATVTFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVWET 115
            :|.|..|......::|.:..|.        |:|.|:..:......|:..|.|:|..|:...||:.
plant   115 LASGSSDANLKIWDIRKKGCIQ--------TYKGHSRGISTIRFTPDGRWVVSGGLDNVVKVWDL 171

  Fly   116 STGDVLYEITEHKDTVTETHFSHDGVYLATGDLAGDLFVFKVSEKHDERPILTKIWEYSMSDM-- 178
            :.|.:|:|...|:..:....|......||||..              :|.:  |.|:....::  
plant   172 TAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSA--------------DRTV--KFWDLETFELIG 220

  Fly   179 ---------SWLFWHRAAHILLAGSDSGEVFVFRIPSGECKILPGQSSRCESGELSG-------- 226
                     ..:.:|.....|..|.|.           ..|:...:...|..|...|        
plant   221 STRPEATGVRSIKFHPDGRTLFCGLDD-----------SLKVYSWEPVVCHDGVDMGWSTLGDLC 274

  Fly   227 --DGKKLFTAYVNGSVKLWDLKSCQVLIDVNESHPMGFG-----EITHAVVAC------------ 272
              :||.|..:|...||.:|       :.|:::..|.|.|     |....:::.            
plant   275 ISEGKLLGCSYYQNSVGIW-------VSDISQIEPYGIGSADKKECVEKILSALDDQSFDRIKST 332

  Fly   273 --ERESPFY-----------------VCAEASGECSSGKGIRYNTSFHNKTIRKMLFCTNNGPVS 318
              ...||.|                 ..|..||..|: .......:..||::........:..:.
plant   333 PRRSSSPDYETKEIKNIYIDSTGGNSAVAHKSGSLST-PATSTGQAGDNKSLVVHSVVPRDSDIG 396

  Fly   319 TIQSEHGIECLAFAPSSADLKLFACGSLDGRISIWDYAKSALRTICENPVPNDAVIRI------- 376
            ...|:.|.|.:.|:.:...:.|...           |.:.......|....:.||..:       
plant   397 KDSSDSGKESITFSKTKPGMLLRPA-----------YVRKTPTKFDETKKQSVAVGYLKKSGLDG 450

  Fly   377 -KWLNDHTILAATSQGNLNAFDARTGILKFTLTGHYYHIYEFVYKPQENLLLTVSEDNTAK--IF 438
             |.|:..|...:...|. |.:||...|:| ::|..:           |..||..|..:.||  :.
plant   451 EKKLDTETAFDSEMSGR-NPYDADDSIIK-SITNKF-----------EQALLPESPTDEAKCMLL 502

  Fly   439 KVP 441
            |.|
plant   503 KPP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 76/426 (18%)
WD40 <81..441 CDD:225201 77/426 (18%)
WD40 repeat 89..126 CDD:293791 10/36 (28%)
WD40 repeat 132..170 CDD:293791 6/37 (16%)
WD40 repeat 175..213 CDD:293791 5/48 (10%)
WD40 repeat 220..299 CDD:293791 21/124 (17%)
WD40 repeat 266..321 CDD:293791 9/85 (11%)
WD40 repeat 326..365 CDD:293791 4/38 (11%)
WD40 repeat 373..408 CDD:293791 10/42 (24%)
WD40 repeat 414..438 CDD:293791 6/25 (24%)
DWA3NP_176316.4 WD40 8..260 CDD:238121 32/179 (18%)
WD40 repeat 19..56 CDD:293791
WD40 repeat 61..97 CDD:293791
WD40 repeat 104..139 CDD:293791 6/31 (19%)
WD40 repeat 145..181 CDD:293791 10/35 (29%)
WD40 repeat 187..222 CDD:293791 8/50 (16%)
WD40 repeat 229..252 CDD:293791 5/33 (15%)
Herpes_BLLF1 <670..>908 CDD:282904
Katanin_con80 1024..1175 CDD:404758
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.