DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and AT3G15610

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_566519.1 Gene:AT3G15610 / 820803 AraportID:AT3G15610 Length:341 Species:Arabidopsis thaliana


Alignment Length:297 Identity:89/297 - (29%)
Similarity:131/297 - (44%) Gaps:40/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EEDEEELRDRERIAAITDEATVTFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVWETSTGDVLYE 123
            ::.:..||:.|     |.:...||:.|...|::..|..|...|.:.|.|..|.:|:..|||||:.
plant    39 KDSQPMLRNGE-----TGDWIGTFEGHKGAVWSSCLDNNALRAASASADFSAKLWDALTGDVLHS 98

  Fly   124 ITEHKDTVTETHFSHDGVYLATGDLAGDLFVFKVSEKHDERPILTKIWEYSMSDMSWLFWHRAAH 188
            . |||..|....||.|..||.||.....|.||.:: :.|..|........|:..::||  |....
plant    99 F-EHKHIVRACAFSQDTKYLITGGFEKILRVFDLN-RLDAPPTEIDKSPGSIRTLTWL--HGDQT 159

  Fly   189 ILLAGSDSGEVFVFRIPSGECKILPGQSSRCESGELSGDGKKLFTAYVNGS-VKLWDLKSCQVLI 252
            ||.:.:|.|.|.::.:.||:........|...|.|:|.||:.:.||  :|| ||.||        
plant   160 ILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTA--DGSTVKFWD-------- 214

  Fly   253 DVNESHPMGFGEITHAVVACERESPFYVCAEASGECSSGKGIRYNTSFHNKTIRKMLFCTNNGPV 317
               .:|   ||.:....:.|..||       ||.|..||.  ::.....:..:|...|.|.. .:
plant   215 ---ANH---FGLVKSYDMPCNIES-------ASLEPKSGN--KFVAGGEDMWVRLFDFHTGK-EI 263

  Fly   318 STIQSEHG-IECLAFAPSSADLKLFACGSLDGRISIW 353
            ...:..|| :.|:.|||:.   :.:|.||.||.|.||
plant   264 GCNKGHHGPVHCVRFAPTG---ESYASGSEDGTIRIW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 85/277 (31%)
WD40 <81..441 CDD:225201 85/275 (31%)
WD40 repeat 89..126 CDD:293791 13/36 (36%)
WD40 repeat 132..170 CDD:293791 12/37 (32%)
WD40 repeat 175..213 CDD:293791 10/37 (27%)
WD40 repeat 220..299 CDD:293791 24/79 (30%)
WD40 repeat 266..321 CDD:293791 11/54 (20%)
WD40 repeat 326..365 CDD:293791 12/28 (43%)
WD40 repeat 373..408 CDD:293791
WD40 repeat 414..438 CDD:293791
AT3G15610NP_566519.1 WD40 14..298 CDD:238121 89/297 (30%)
WD40 repeat 20..59 CDD:293791 6/24 (25%)
WD40 repeat 106..143 CDD:293791 12/37 (32%)
WD40 repeat 148..185 CDD:293791 10/38 (26%)
WD40 repeat 191..225 CDD:293791 16/49 (33%)
WD40 repeat 230..267 CDD:293791 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.