DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and emb1345

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_565615.1 Gene:emb1345 / 817147 AraportID:AT2G26060 Length:352 Species:Arabidopsis thaliana


Alignment Length:392 Identity:77/392 - (19%)
Similarity:140/392 - (35%) Gaps:96/392 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DELQEIIELEE-QPLDEDDDDLEEVTLEQLEAR-------LAMAGGDDDEEEDEEELRDRERIAA 73
            |.:::.:||.| |.|:...|.:..|....:.:.       ||...||:.....|:....|.... 
plant     2 DLMEKNLELVEIQKLEGHTDRVWSVAWNPVSSHADGVSPILASCSGDNTVRIWEQSSLSRSWTC- 65

  Fly    74 ITDEATVTFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVWET--STGDVLYEITEHKDTVTETHF 136
                .||..:.||..|.:|:..|:.....|.|.|....:|:.  |..:.:..:..|::.|....:
plant    66 ----KTVLEETHTRTVRSCAWSPSGQLLATASFDGTTGIWKNYGSEFECISTLEGHENEVKSVSW 126

  Fly   137 SHDGVYLATGDLAGDLFVFKVSE--KHDERPILTKIWEYSMSDMSWLFWHRAAHILLAGSDSGEV 199
            :..|..|||......:::::|.|  ::|...:||.    ...|:..:.||....:|.:.|....:
plant   127 NASGSCLATCSRDKSVWIWEVLEGNEYDCAAVLTG----HTQDVKMVQWHPTMDVLFSCSYDNTI 187

  Fly   200 FVF--RIPSGECKILP-------GQSSRCESGELSGDGKKLFTAYVNGSVKLW--DLKSCQVLID 253
            .|:  ....||.:.:.       |.||...|...:..|.|:.|...:.::|:|  |:...|    
plant   188 KVWWSEDDDGEYQCVQTLGESNNGHSSTVWSISFNAAGDKMVTCSDDLTLKIWGTDIAKMQ---- 248

  Fly   254 VNESHPMGFGEITHAVVACERESPFYVCAEASGECSSGKGIRYNTSFHNKTIRK----------- 307
                             :.|..:|:......||             :|::||..           
plant   249 -----------------SGEEYAPWIHLCTLSG-------------YHDRTIYSAHWSRDDIIAS 283

  Fly   308 -------MLFCTN-----NGPVSTI------QSEHGIECLAFAPSSADLKLFACGSLDGRISIWD 354
                   .||..:     :||...:      ..|:.:..:.::|...: :|.|..|.||.:.||.
plant   284 GAGDNAIRLFVDSKHDSVDGPSYNLLLKKNKAHENDVNSVQWSPGEGN-RLLASASDDGMVKIWQ 347

  Fly   355 YA 356
            .|
plant   348 LA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 63/322 (20%)
WD40 <81..441 CDD:225201 61/320 (19%)
WD40 repeat 89..126 CDD:293791 8/38 (21%)
WD40 repeat 132..170 CDD:293791 9/39 (23%)
WD40 repeat 175..213 CDD:293791 8/39 (21%)
WD40 repeat 220..299 CDD:293791 12/80 (15%)
WD40 repeat 266..321 CDD:293791 11/83 (13%)
WD40 repeat 326..365 CDD:293791 9/31 (29%)
WD40 repeat 373..408 CDD:293791
WD40 repeat 414..438 CDD:293791
emb1345NP_565615.1 WD40 12..347 CDD:238121 72/378 (19%)
WD40 repeat 23..71 CDD:293791 9/52 (17%)
WD40 repeat 78..116 CDD:293791 7/37 (19%)
WD40 repeat 121..160 CDD:293791 8/38 (21%)
WD40 repeat 167..206 CDD:293791 7/38 (18%)
WD40 repeat 216..263 CDD:293791 10/67 (15%)
WD40 repeat 270..313 CDD:293791 5/42 (12%)
WD40 repeat 320..346 CDD:293791 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.