DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and Wdr61

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001020546.1 Gene:Wdr61 / 66317 MGIID:1917493 Length:305 Species:Mus musculus


Alignment Length:391 Identity:71/391 - (18%)
Similarity:131/391 - (33%) Gaps:110/391 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ITDEATVTFKKHTAPVFACSLHPNYNWA--------------VTGSEDD--RAFVWETSTGDVLY 122
            :|::.::.||:..|       |.:..|:              ||||.||  :.:.|.....::.:
Mouse     1 MTNQYSILFKQEQA-------HDDAIWSVAWETNKKENIETVVTGSLDDLVKVWKWRDERLELQW 58

  Fly   123 EITEHKDTVTETHFSHDGVYLATGDLAG-----DLFVFKVSEKHDERPILTKIWEYSMSDMSWLF 182
            .:..|:..|.....||.....|:..|..     ||...|..:..|..|:  ..|..:.|..|   
Mouse    59 SLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQMKSIDAGPV--DAWTLAFSPDS--- 118

  Fly   183 WHRAAHILLAGSDSGEVFVFRIPSGECKI-LPGQSSRCESGELSGDGKKLFTAYVNGSVKLWDLK 246
                 ..|..|:..|:|.:|.:.||:.:. |..:.....|...|.|||.|.:..::|.:.::|:.
Mouse   119 -----QYLATGTHMGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIA 178

  Fly   247 SCQVLIDVNESHPMGFGEITHAVVACERESPFYVCAEASGECSSGKGIRYNTSFHNKTIRKMLFC 311
            :               |::.|.:..                             |...||.:.| 
Mouse   179 T---------------GKLLHTLEG-----------------------------HAMPIRSLTF- 198

  Fly   312 TNNGPVSTIQSEHGIECLAFAPSSADLKLFACGSLDGRISIWDYAKSALRTICENPVPNDAVIRI 376
                                   |.|.:|....|.||.|.|:|...:.|........  ..|:.:
Mouse   199 -----------------------SPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHA--SWVLNV 238

  Fly   377 KWLNDHT-ILAATSQGNLNAFDARTGILKFTLTGHYYHIYEFVYKPQENLLLTVSEDNTAKIFKV 440
            .:..|.| .::::|..::..:|..|.....|...|...::...|....:.:::|.:|....::..
Mouse   239 AFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHVYDC 303

  Fly   441 P 441
            |
Mouse   304 P 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 69/382 (18%)
WD40 <81..441 CDD:225201 69/382 (18%)
WD40 repeat 89..126 CDD:293791 9/52 (17%)
WD40 repeat 132..170 CDD:293791 9/42 (21%)
WD40 repeat 175..213 CDD:293791 9/38 (24%)
WD40 repeat 220..299 CDD:293791 10/78 (13%)
WD40 repeat 266..321 CDD:293791 5/54 (9%)
WD40 repeat 326..365 CDD:293791 10/38 (26%)
WD40 repeat 373..408 CDD:293791 7/35 (20%)
WD40 repeat 414..438 CDD:293791 3/23 (13%)
Wdr61NP_001020546.1 WD40 13..302 CDD:238121 67/375 (18%)
WD 1 14..57 10/49 (20%)
WD40 repeat 19..62 CDD:293791 8/42 (19%)
WD 2 62..101 9/38 (24%)
WD40 repeat 68..105 CDD:293791 8/36 (22%)
WD 3 104..143 11/48 (23%)
WD40 repeat 110..146 CDD:293791 11/43 (26%)
WD 4 146..187 10/55 (18%)
WD40 repeat 152..188 CDD:293791 10/50 (20%)
WD 5 188..227 14/91 (15%)
WD40 repeat 193..229 CDD:293791 13/59 (22%)
WD 6 230..269 6/40 (15%)
WD40 repeat 236..271 CDD:293791 6/34 (18%)
WD 7 272..305 5/33 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.