DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and Mlst8

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_071799.2 Gene:Mlst8 / 64226 RGDID:69242 Length:326 Species:Rattus norvegicus


Alignment Length:235 Identity:53/235 - (22%)
Similarity:88/235 - (37%) Gaps:56/235 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EARLAMAGGDDDEEEDEEELRDR----ERIAAITDEATVTFKKHTAPVFACSLHPNYNWAVTGSE 106
            :.|....||:|.... ..:||.|    :||..:           .||:....||||....:.|.:
  Rat    96 DGRWMYTGGEDCTAR-IWDLRSRNLQCQRIFQV-----------NAPINCVCLHPNQAELIVGDQ 148

  Fly   107 DDRAFVWETSTGDVLYEITEHKDTVTETHFSHDGVYLATGDLAGDLFVFKVSEK-HDERPIL--- 167
            .....:|:..|......|.|.:.::|..|...|..|:|..:.||:.||:.::.. .||...|   
  Rat   149 SGAIHIWDLKTDHNEQLIPEPEFSITSAHIDPDASYMAAVNSAGNCFVWNLTGGIGDEVTQLIPK 213

  Fly   168 TKIWEYSMSDMSWLFWHRAAHILLAGSDSGEVFVFRIPSGECKIL-----------------PGQ 215
            |||..::...:...|...:..:....:|.           .|||.                 ||:
  Rat   214 TKIPAHTRYALQCRFSPDSTLLATCSADQ-----------TCKIWRTSNFSLMTELSIKSSNPGE 267

  Fly   216 SSR-----CESGELSGDGKKLFTAYVNGSVKLWDLKSCQV 250
            |||     |   ..|||.:.:.||..:...:||.:::.::
  Rat   268 SSRGWMWGC---AFSGDSQYIVTASSDNLARLWCVETGEI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 44/198 (22%)
WD40 <81..441 CDD:225201 44/196 (22%)
WD40 repeat 89..126 CDD:293791 8/36 (22%)
WD40 repeat 132..170 CDD:293791 13/41 (32%)
WD40 repeat 175..213 CDD:293791 5/54 (9%)
WD40 repeat 220..299 CDD:293791 7/31 (23%)
WD40 repeat 266..321 CDD:293791
WD40 repeat 326..365 CDD:293791
WD40 repeat 373..408 CDD:293791
WD40 repeat 414..438 CDD:293791
Mlst8NP_071799.2 WD 1 1..37
WD40 14..297 CDD:238121 51/226 (23%)
WD 2 40..80
WD40 repeat 47..83 CDD:293791
WD 3 83..122 7/26 (27%)
WD40 repeat 89..127 CDD:293791 9/31 (29%)
WD 4 126..165 9/49 (18%)
WD40 repeat 131..167 CDD:293791 7/35 (20%)
WD 5 168..207 11/38 (29%)
WD40 repeat 174..217 CDD:293791 14/42 (33%)
WD 6 218..257 5/49 (10%)
WD40 repeat 224..258 CDD:293791 5/44 (11%)
WD 7 268..309 11/40 (28%)
WD40 repeat 273..299 CDD:293791 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.