DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and MLST8

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_005255532.2 Gene:MLST8 / 64223 HGNCID:24825 Length:351 Species:Homo sapiens


Alignment Length:236 Identity:53/236 - (22%)
Similarity:89/236 - (37%) Gaps:58/236 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EARLAMAGGDDDEEEDEEELRDR----ERIAAITDEATVTFKKHTAPVFACSLHPNYNWAVTGSE 106
            :.|....||:|.... ..:||.|    :||..:           .||:....||||....:.|.:
Human   121 DGRWMYTGGEDCTAR-IWDLRSRNLQCQRIFQV-----------NAPINCVCLHPNQAELIVGDQ 173

  Fly   107 DDRAFVWETSTGDVLYEITEHKDTVTETHFSHDGVYLATGDLAGDLFVFKVSEK-HDERPIL--- 167
            .....:|:..|......|.|.:.::|..|...|..|:|..:..|:.:|:.::.. .||...|   
Human   174 SGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPK 238

  Fly   168 TKI---WEYSM---------------SDMSWLFWHRAAHILLAGSDSGEVFVFRIPSGECKILPG 214
            |||   ..|::               :|.:...|..:...|:.        ...|.||.    ||
Human   239 TKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMT--------ELSIKSGN----PG 291

  Fly   215 QSSR-----CESGELSGDGKKLFTAYVNGSVKLWDLKSCQV 250
            :|||     |   ..|||.:.:.||..:...:||.:::.::
Human   292 ESSRGWMWGC---AFSGDSQYIVTASSDNLARLWCVETGEI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 44/199 (22%)
WD40 <81..441 CDD:225201 44/197 (22%)
WD40 repeat 89..126 CDD:293791 8/36 (22%)
WD40 repeat 132..170 CDD:293791 11/41 (27%)
WD40 repeat 175..213 CDD:293791 6/52 (12%)
WD40 repeat 220..299 CDD:293791 7/31 (23%)
WD40 repeat 266..321 CDD:293791
WD40 repeat 326..365 CDD:293791
WD40 repeat 373..408 CDD:293791
WD40 repeat 414..438 CDD:293791
MLST8XP_005255532.2 WD40 <17..330 CDD:225201 53/236 (22%)
WD40 33..322 CDD:238121 51/227 (22%)
WD40 repeat 66..108 CDD:293791
WD40 repeat 114..152 CDD:293791 9/31 (29%)
WD40 repeat 156..192 CDD:293791 7/35 (20%)
WD40 repeat 199..242 CDD:293791 12/42 (29%)
WD40 repeat 249..283 CDD:293791 3/41 (7%)
WD40 repeat 298..324 CDD:293791 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.