DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and tbl1x

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001076463.1 Gene:tbl1x / 560294 ZFINID:ZDB-GENE-070209-131 Length:510 Species:Danio rerio


Alignment Length:419 Identity:82/419 - (19%)
Similarity:136/419 - (32%) Gaps:132/419 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DDDEEEDEEELRDRERIAAITDEATVTFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVW----ET 115
            ||.|.|.|.|       |.|........:.|.:.||.|:.:|..:...:||.|..|.:|    .:
Zfish   144 DDMEMEVEGE-------AQIPPSKATVLRGHESEVFICAWNPVCDLLASGSGDSTARIWNLIENS 201

  Fly   116 STGDVL--------YEITEHKDTVTETHFSHDGVYLATGDLAGDLFVFKVSEKHDERPILTKIWE 172
            ||..||        .::..:|| ||...::.:|..||||...|                ..:||.
Zfish   202 STQLVLRHCIREGGQDVPSNKD-VTSLDWNSEGTLLATGSYDG----------------FARIWT 249

  Fly   173 YSMSDMSWLFWHRAAHILLAGSDSGEVFVFRIPSGECKILPGQSSRCESGELSGDGKKLFTAYVN 237
            ...:..|.|           |...|.:|..:                    .:..|..:.:|.|:
Zfish   250 KDGNLSSTL-----------GQHKGPIFALK--------------------WNKKGNSILSAGVD 283

  Fly   238 GSVKLWDLKSCQV----------LIDVNESHPMGFGEITHAVVACERESPFYVCAEASGECSSGK 292
            .:..:||..:.:.          .:||:..:...|       .:|..:...:||...|       
Zfish   284 KTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNSTF-------ASCSTDMCIHVCRLGS------- 334

  Fly   293 GIRYNTSFHNKTIRKMLFCTNNGPVSTIQSE-HGIECLAFAPSSADLKLFACGSLDGRISIWDYA 356
                                 ..|:.|.|.. :.:..:.:.||.   .|.|..|.|..:.||...
Zfish   335 ---------------------ERPLKTFQGHTNEVNAIKWDPSG---MLLASCSDDMTLKIWSMK 375

  Fly   357 KSALRTICENPVP--NDAVIRIKWL---------NDHTILAATS-QGNLNAFDARTGILKFTLTG 409
            :.:    |.:.:.  :..:..|||.         |.:.:||:.| ...:..:|...|:...|||.
Zfish   376 QDS----CVHDLQAHSKEIYTIKWSPTGIGSNNPNANILLASASFDSTVRLWDVDRGVCTHTLTR 436

  Fly   410 HYYHIYEFVYKPQENLLLTVSEDNTAKIF 438
            |...:|...:.|....|.:.|.|....|:
Zfish   437 HQEPVYSVAFSPDGKFLASGSFDKCVHIW 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 74/395 (19%)
WD40 <81..441 CDD:225201 74/393 (19%)
WD40 repeat 89..126 CDD:293791 13/48 (27%)
WD40 repeat 132..170 CDD:293791 7/37 (19%)
WD40 repeat 175..213 CDD:293791 5/37 (14%)
WD40 repeat 220..299 CDD:293791 12/88 (14%)
WD40 repeat 266..321 CDD:293791 6/54 (11%)
WD40 repeat 326..365 CDD:293791 8/38 (21%)
WD40 repeat 373..408 CDD:293791 10/44 (23%)
WD40 repeat 414..438 CDD:293791 5/23 (22%)
tbl1xNP_001076463.1 LisH 6..32 CDD:285685
WD40 163..466 CDD:238121 74/393 (19%)
WD40 <164..300 CDD:225201 36/183 (20%)
WD40 repeat 171..211 CDD:293791 13/39 (33%)
WD40 repeat 225..260 CDD:293791 11/61 (18%)
WD40 repeat 265..342 CDD:293791 15/131 (11%)
eIF2A 268..476 CDD:285825 43/260 (17%)
WD40 repeat 349..384 CDD:293791 9/41 (22%)
WD40 repeat 390..435 CDD:293791 10/44 (23%)
WD40 repeat 441..479 CDD:293791 6/25 (24%)
WD40 repeat 482..505 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.