DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and spra

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001019601.2 Gene:spra / 554136 ZFINID:ZDB-GENE-050522-412 Length:261 Species:Danio rerio


Alignment Length:249 Identity:52/249 - (20%)
Similarity:81/249 - (32%) Gaps:69/249 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 STGDVLY-------EITEHKDTVT--ETHFSHDGVYLATGDLAGDLFVFK-VSEKHDERPILTKI 170
            |.|.||.       ::.|.|..:|  ||..:   |.....||..:..|.| ::|..|.:|.:..:
Zfish    34 SPGSVLVLAARSEEQLLELKSALTRGETGLT---VRCVPVDLGCEAGVEKLIAETRDIQPDIQHL 95

  Fly   171 WEYSMSDMSWLFWHRAAHILLAGSDSGEVFVFRIPSGECKILPGQSSRCESGELSGDGKKLFTAY 235
                      |.:|.||.:       |:|      |..|:.............|:.......|| 
Zfish    96 ----------LLFHNAASL-------GDV------SRYCRDFTNMEELNSYLSLNVSSALCLTA- 136

  Fly   236 VNGSVKLWDLKSCQVLIDVNESHPMGFGEITHAVVACE----RESPFYVCAEASGECSSGKGIRY 296
              |.::.:..:|....:.||.|...........|..|.    |:..|.|.||...|         
Zfish   137 --GVLRTYPKRSGLTRVIVNISSLCALRPFPTWVQYCSGKAARDMMFRVLAEEEPE--------- 190

  Fly   297 NTSFHNKTIRKMLFCTNNGPVST-IQSEHGIECL------AFAPSSADLKLFAC 343
                    :|.:.:..  ||:.| :|.|....|.      .|:...|:.:|..|
Zfish   191 --------LRVLNYAP--GPLDTDMQREARSSCADSELRNTFSQMHANGQLLTC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 52/249 (21%)
WD40 <81..441 CDD:225201 52/249 (21%)
WD40 repeat 89..126 CDD:293791 4/16 (25%)
WD40 repeat 132..170 CDD:293791 11/40 (28%)
WD40 repeat 175..213 CDD:293791 8/37 (22%)
WD40 repeat 220..299 CDD:293791 16/82 (20%)
WD40 repeat 266..321 CDD:293791 12/59 (20%)
WD40 repeat 326..365 CDD:293791 5/24 (21%)
WD40 repeat 373..408 CDD:293791
WD40 repeat 414..438 CDD:293791
spraNP_001019601.2 SPR-like_SDR_c 11..260 CDD:187625 52/249 (21%)
adh_short 12..211 CDD:278532 47/224 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100610
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.