DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and tbl1xr1a

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_005172880.1 Gene:tbl1xr1a / 553608 ZFINID:ZDB-GENE-050522-314 Length:513 Species:Danio rerio


Alignment Length:396 Identity:77/396 - (19%)
Similarity:133/396 - (33%) Gaps:114/396 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ITDEATVTFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVW-------ETSTGDVL--------YE 123
            |.....:..:.|.:.||.|:.:|..:...:||.|..|.:|       .:||..||        .:
Zfish   156 IPQNKAMVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSSSSSTQLVLRHCIREGGQD 220

  Fly   124 ITEHKDTVTETHFSHDGVYLATGDLAGDLFVFKVSEKHDERPILTKIWEYSMSDMSWLFWHRAAH 188
            :..:|| ||...::.:|..||||...|                ..:||....:..|.|       
Zfish   221 VPSNKD-VTSLDWNSEGTLLATGSYDG----------------FARIWTKDGNLASTL------- 261

  Fly   189 ILLAGSDSGEVFVFRIPSGECKILPGQSSRCESGELSGDGKKLFTAYVNGSVKLWDLKSCQVLID 253
                |...|.:|..:                    .:..|..:.:|.|:.:..:||..:      
Zfish   262 ----GQHKGPIFALK--------------------WNKKGNFILSAGVDKTTIIWDAHT------ 296

  Fly   254 VNESHPMGFGEITHAVVACERESPFYVCAEASGECSSGKGIRYNTSFHNKTIRKMLFCTNNG--- 315
                     ||       .:::.||:.......:..|      |.:|.:.:....:.....|   
Zfish   297 ---------GE-------AKQQFPFHSAPALDVDWQS------NNTFASCSTDMCIHVCKLGQDR 339

  Fly   316 PVSTIQSE-HGIECLAFAPSSADLKLFACGSLDGRISIWDYAKSALRTICENPVP--NDAVIRIK 377
            |:.|.|.. :.:..:.:.|:.   .|.|..|.|..:.||    |..:..|.:.:.  :..:..||
Zfish   340 PIKTFQGHTNEVNAIKWDPTG---NLLASCSDDMTLKIW----SMKQDTCVHDLQAHSKEIYTIK 397

  Fly   378 WL---------NDHTILAATS-QGNLNAFDARTGILKFTLTGHYYHIYEFVYKPQENLLLTVSED 432
            |.         |.:.:||:.| ...:..:|...||...|||.|...:|...:.|....|.:.|.|
Zfish   398 WSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRHLASGSFD 462

  Fly   433 NTAKIF 438
            ....|:
Zfish   463 KCVHIW 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 76/391 (19%)
WD40 <81..441 CDD:225201 76/389 (20%)
WD40 repeat 89..126 CDD:293791 13/51 (25%)
WD40 repeat 132..170 CDD:293791 7/37 (19%)
WD40 repeat 175..213 CDD:293791 5/37 (14%)
WD40 repeat 220..299 CDD:293791 11/78 (14%)
WD40 repeat 266..321 CDD:293791 8/57 (14%)
WD40 repeat 326..365 CDD:293791 8/38 (21%)
WD40 repeat 373..408 CDD:293791 11/44 (25%)
WD40 repeat 414..438 CDD:293791 5/23 (22%)
tbl1xr1aXP_005172880.1 LisH 6..32 CDD:285685
WD40 <153..303 CDD:225201 39/216 (18%)
WD40 163..469 CDD:238121 76/389 (20%)
WD40 repeat 171..214 CDD:293791 13/42 (31%)
WD40 repeat 227..263 CDD:293791 12/62 (19%)
WD40 repeat 268..305 CDD:293791 8/78 (10%)
eIF2A 271..479 CDD:285825 45/253 (18%)
WD40 repeat 311..346 CDD:293791 6/40 (15%)
WD40 repeat 351..387 CDD:293791 9/42 (21%)
WD40 repeat 394..438 CDD:293791 11/43 (26%)
WD40 repeat 444..480 CDD:293791 6/25 (24%)
WD40 repeat 485..511 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.